KEGG   Mus musculus (mouse): 27218Help
Entry
27218             CDS       T01002                                 

Gene name
Slamf1, 4933415F16, AA177906, CD150, CDw150, ESTM51, IPO-3, Slam
Definition
(RefSeq) signaling lymphocytic activation molecule family member 1
  KO
K06536  signaling lymphocytic activation molecule family member 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05162  Measles
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    27218 (Slamf1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    27218 (Slamf1)
CD molecules [BR:mmu04090]
 Proteins
  27218 (Slamf1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SLAM Ig_3 Ig_2 ig Receptor_2B4 I-set DUF3328 TMEM154 HIG_1_N DUF3844
Motif
Other DBs
NCBI-GeneID: 27218
NCBI-ProteinID: NP_038758
MGI: 1351314
Ensembl: ENSMUSG00000015316
Vega: OTTMUSG00000035822
UniProt: Q9QUM4 Q544K1
Position
1 H3; 1 79.54 cM
AA seq 343 aa AA seqDB search
MDPKGSLSWRILLFLSLAFELSYGTGGGVMDCPVILQKLGQDTWLPLTNEHQINKSVNKS
VRILVTMATSPGSKSNKKIVSFDLSKGSYPDHLEDGYHFQSKNLSLKILGNRRESEGWYL
VSVEENVSVQQFCKQLKLYEQVSPPEIKVLNKTQENENGTCSLLLACTVKKGDHVTYSWS
DEAGTHLLSRANRSHLLHITLSNQHQDSIYNCTASNPVSSISRTFNLSSQACKQESSSES
SPWMQYTLVPLGVVIIFILVFTAIIMMKRQGKSNHCQPPVEEKSLTIYAQVQKSGPQEKK
LHDALTDQDPCTTIYVAATEPAPESVQEPNPTTVYASVTLPES
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atggatcccaaaggatccctttcctggagaatacttctgtttctctccctggcttttgag
ttgagctacggaacaggtggaggtgtgatggattgcccagtgattctccagaagctggga
caggacacgtggctgcccctgacgaatgaacatcagataaataagagcgtgaacaaaagt
gtccgcatcctcgtcaccatggcgacgtccccaggaagcaaatccaacaagaaaattgtg
tcttttgatctctctaaagggagctatccagatcacctggaggatggctaccactttcaa
tcaaaaaacctgagcctgaagatcctcgggaacaggcgggagagtgaaggatggtacttg
gtgagcgtggaggagaacgtttctgttcagcaattctgcaagcagctgaagctttatgaa
caggtctcccctccagagattaaagtgctaaacaaaacccaggagaacgagaatgggacc
tgcagcttgctgttggcctgcacagtgaagaaaggggaccatgtgacttacagctggagt
gatgaggcaggcacccacctgctgagccgagccaaccgctcccacctcctgcacatcact
cttagcaaccagcatcaagacagcatctacaactgcaccgcaagcaaccctgtcagcagt
atctctaggaccttcaacctatcatcgcaagcatgcaagcaggaatcctcctcagaatcg
agtccatggatgcaatatactcttgtaccactgggggtcgttataatcttcatcctggtt
ttcacggcaataataatgatgaaaagacaaggtaaatcaaatcactgccagccaccagtg
gaagaaaaaagccttactatttatgcccaagtacagaaatcagggcctcaagagaagaaa
cttcatgatgccctaacagatcaggacccctgcacaaccatttatgtggctgccacagag
cctgccccagagtctgtccaggaaccaaaccccaccacagtttatgccagtgtgacactg
ccagagagctga

DBGET integrated database retrieval system