KEGG   Mus musculus (mouse): 27221Help
Entry
27221             CDS       T01002                                 

Gene name
Chaf1a, AL023013, AL024058, CAF-1, Cac1p
Definition
(RefSeq) chromatin assembly factor 1, subunit A (p150)
  KO
K10750  chromatin assembly factor 1 subunit A
Organism
mmu  Mus musculus (mouse)
Brite
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histone chaperones
    CAF-1
     27221 (Chaf1a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CAF1-p150_C2 CAF1-p150_N CAF-1_p150 CAF1A SprA-related DUF936
Motif
Other DBs
NCBI-GeneID: 27221
NCBI-ProteinID: NP_038761
MGI: 1351331
Ensembl: ENSMUSG00000002835
UniProt: Q9QWF0
Structure
PDB: 

Position
17; 17 D
AA seq 911 aa AA seqDB search
MLEEPEAATRTAAAVDCKDRPGFPVKRLIQARLPFKRLNLVPKEKVEEDTSPKAAVESKV
PDLQLSLGTFESQCHTGSHVGLSTKLVGGQGPIDSFLRATIKPVPSVVIIDLTENCSDIP
DSPEGHSELSPDTAGVVTTVEGAAKQQEHSAAELCLLETPSDITCHMEEEPGSPGDPKRT
GDCQAGSLQSCPELTPGSRTCPTKELSSWSKAGDLLFIEKVPVVVLEDILATKPSIASLP
MMSLDRSVTSESEILESCPEDDSILSHSSTNSSSPTSSPEGPSTPPEHRGGRSSPSTPAC
RVAKNFVKGSTEKGRSKLHRDREQQREEKEKLREEIRRAKEEARKKKEEEKELKEKERRE
KREKDEKEKAEKQRLKEEKRKERQEALEAKLEEKRKKEEEKRLREEEKRLREEEKRIKAE
KAEITRFFQKPKTPQAPKTLAGSCGKFAPFEIKEHMVLAPRCRAALDQDLCDQLDQLLQQ
QSVASTFLSDLKSRLPLRSGPTRVCGHDTDIMNRDVVIVESSKVDGVSERKKFGRMKLLQ
FSENHRPAYWGTWNKKTAIIRPRNPWAQDKDLLDYEVDSDDEWEEEEPGESLSHSEGDED
DDVGEDEDEDDGFFVPHGYLSEDEGVTEECADPENHKVHQKLKAKEWDELLAKGKRFRVL
QPVHVGCVWASEAANCTSSDLKLLQQFTACLLDVASPDEPEPGASRREKRDQHILAQLLP
LLHGNVNGSKVIIHEFQEQCRRGLLTLPSPTPHLQMPNLEDAVAVPSKARLKRLISENSA
YEKRPNFRMCWYVHPEVLKSFGQECLPVPCQWTYITTMPSAPREDSGSASTEGPGQSTPM
LLKRKPAATMCITQFMKKRRYDGQVGSGDMDGFQADTEEDEEDDTDCMIIDVPDVGSDVS
EAPIPAPTLCK
NT seq 2736 nt NT seq  +upstreamnt  +downstreamnt
atgttggaggagccggaggccgcgacgcggacagccgcggccgtggattgcaaagacaga
cccgggttcccagtgaagaggttaatacaagcccgcttgcccttcaaacgcctgaacctt
gttcccaaggagaaagttgaggaagacacatcaccaaaagcagctgtggaaagcaaagtc
ccggatctacaattgtctttgggcacttttgaaagccagtgtcacacaggctctcacgta
ggcttgagtacaaagttggtcggtggccagggccccattgatagcttcttgagggcaaca
atcaagccagtaccgagtgtggtcattatcgacctgacggagaactgcagtgacattcca
gacagccctgagggccacagtgaactaagtcctgacactgctggtgtggtcaccacagtg
gaaggagctgccaagcagcaggagcactctgcagcagagctgtgtctcctagagacccct
tcagacatcacttgtcacatggaagaggagcctgggagtccaggagacccaaagaggacg
ggtgactgtcaggctggttcactacagagctgtccggagctgaccccaggttctaggaca
tgccccaccaaggagttatcaagctggagcaaggcaggggatctcctatttatagagaaa
gtgcctgtggtggtgctagaggacatcctggccactaagccctccattgcctctcttccc
atgatgtccctggataggagtgtcacttcagagagtgaaatactggagtcctgccccgag
gatgactccatactgagccactcctccaccaactcctcttctccaaccagctctcctgag
ggaccatccacacccccagaacatcggggtgggagaagctccccctccaccccagcctgc
agagttgccaagaactttgtcaaaggctccacagagaagggcaggagcaaactgcacaga
gatagagaacagcagagggaagagaaggaaaagctgagggaagagatacgacgagccaag
gaggaggcacggaagaagaaggaggaggagaaggagctgaaggaaaaggagcggagggaa
aagcgggagaaagatgagaaggagaaggcggagaagcagcggctaaaggaggaaaaacgc
aaggagcggcaggaagctctggaggctaaactggaggagaagaggaagaaggaggaagag
aagcggttacgggaggaagagaagcggttacgggaagaagagaagcgcattaaggcagaa
aaggcagagatcactcgattcttccagaaaccgaagactccgcaggctcccaagaccctg
gccggttcctgtggtaagtttgccccctttgaaatcaaagaacacatggtgctggctcca
cggtgccgagctgccttggatcaagacctgtgcgatcagctggaccagctcctgcagcag
cagagtgtggcaagcaccttcctcagtgacctaaaaagccggctgcccttgagatcgggg
cccacccgggtctgtggccatgacacagacatcatgaacagggatgtggtcattgtggag
agcagcaaggtggacggtgtgtctgaaaggaagaagtttggccgcatgaagcttctgcag
ttctcagagaaccaccggccagcatactgggggacgtggaacaagaagacagccatcatc
cgcccccggaacccctgggcccaggacaaagaccttcttgactatgaggtagacagtgac
gatgagtgggaagaggaggaacctggggagtctttgtcccacagtgagggggatgaggat
gacgatgtgggggaagatgaggatgaggacgatggcttctttgtgccccatgggtactta
tctgaagatgaaggcgtgactgaggagtgtgcagaccctgagaaccacaaagtacaccag
aagctgaaggccaaggagtgggatgagctcctagccaagggcaagcgctttcgtgtgctg
cagcctgtgcacgtgggatgtgtatgggcatcagaggcagccaactgcacgagttccgac
ttgaagctgctgcagcagttcactgcatgcctgctggatgtggcatcccctgatgagcca
gaacccggggcctccaggagggaaaagagggaccagcatatcctggcccagttgcttccg
ctgctacatggcaatgtgaatgggagcaaggtgatcatccatgaattccaggagcaatgc
cgcaggggcctgctgacccttccaagtcccaccccacacctgcagatgcccaacttggag
gatgctgttgctgtgccatccaaggccaggctgaagcgccttatctctgagaactctgcc
tatgagaagcggcccaacttccgtatgtgctggtatgtgcacccagaggtgctcaagagc
tttggccaggagtgcctgccagtgccctgccagtggacctacatcaccaccatgccctca
gcacccagggaagacagtggcagtgcttctactgaggggcctggccagagcacacctatg
ctactcaagcggaagccagcggccaccatgtgcatcacgcagtttatgaagaagcggcgc
tatgatggacaggttgggtctggggacatggatggcttccaggcagacacagaagaggat
gaagaggatgacacagactgtatgatcatagatgtgccagatgttgggagtgacgtgtca
gaagctcccatacctgctcccacactttgcaagtga

DBGET integrated database retrieval system