KEGG   Mus musculus (mouse): 27223Help
Entry
27223             CDS       T01002                                 

Gene name
Trp53bp1, 53BP1, Tp53bp1, m53BP1, p53BP1
Definition
(RefSeq) transformation related protein 53 binding protein 1
  KO
K20915  tumor suppressor p53-binding protein 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04621  NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    27223 (Trp53bp1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 53-BP1_Tudor BRCT_3 TUDOR_5 BRCT BRCT_2 DUF4537 RTT107_BRCT_5 Fucose_iso_N1 Tudor_2
Motif
Other DBs
NCBI-GeneID: 27223
NCBI-ProteinID: NP_038763
MGI: 1351320
Ensembl: ENSMUSG00000043909
Vega: OTTMUSG00000015973
UniProt: P70399 Q8BZ87 Q3V1P7
Structure
PDB: 

Position
2; 2 E5
AA seq 1969 aa AA seqDB search
MPGEQMDPTGSQLDSDFSQQDTPCLIIEDSQPESQVLEEDAGSHFSVLSRHLPNLQMHKE
NPVLDIVSNPEQSAVEQGDSNSSFNEHLKEKKASDPVESSHLGTSGSISQVIERLPQPNR
TSSALAVTVEAASLPEEEKEEEELEEEKEGVGANAPGADSLAAEDSASSQLGFGVLELSQ
SQDVEEHTVPYDVNQEHLQLVTTNSGSSPLSDVDASTAIKCEEQPTEDIAMIEQPSKDIP
VTVQPGKGIHVVEEQNLPLVRSEDRPSSPQVSVAAVETKEQVPARELLEEGPQVQPSSEP
EVSSTQEDLFDQSSKTASDGCSTPSREEGGCSPVSTPATTLQLLQLSGQKPLVQESLSTN
SSDLVAPSPDAFRSTPFIVPSSPTEQGGRKDEPMDMSVIPVGGEPFQKLHDDEAMETEKP
LLPSQPAVSPQASTPVSRSTPVFTPGSLPIPSQPEFSHDIFIPSPSLEEPSDDVKKGGGL
HSSSLTVECSKTSESEPKNFTDDLGLSMTGDSCKLMLSTSEYSQSSKMESLGSPRTEEDR
ENTQIDDTEPLSPVSNSKLPADSENVLVTPSQDDQVEMSQNVDKAKEDETEDRGDCKGRE
DAVAEDVCIDLTCDSGSQAVPSPATRSEALSSVLDQEEAMDTKEHHPEEGFSGSEVEEVP
ETPCGSHREEPKEEPMESIPLHLSLTETQSEALCLQKEAPKEECPEAMEVETSVISIDSP
QKLQVLDQELEHKDPDTWEEATSEDSSVVIVDVKEPSPRADVSCEPLEEVEKCSDSQSWE
GVAPEEEPCAENRLDTPEEKRIECDGDSKAETTEKDAVTEDSPQPPLPSVRDEPVRPDQE
TQQPQVQEKESPVTVDAEVADDKQLGPEGACQQLEKAPACASQSFCESSSETPFHFTLPK
EGDIIPPLTGATPPLIGHLKLEPKRHSTPIGISNYPESTIATSDVTSESMVEINDPLLGN
EKGDSESAPEMDGKLSLKMKLVSPETEASEESLQFSLEKPTTAERKNGSTAIAEPVASLQ
KPVPVFGCIYEAQQEKEAQSEAPPSAPDRANLLHFPSAQEEDKERPDVTPKLRQSEQPVK
PVGPVMDDAAPEDSASPVSQQRASQEQRASQEPFSPAEDVMETDLLEGLAANQDRPSKML
MDRPTQSNIGIQTVDHSLCAPETVSAATQTVKSVCEQGTSTAEQNSGKQDATVQTERGSG
EKPASAPVDDTESLHSQGEEEFEMPQPPHGHVLHRHMRTIREVRTLVTRVITDVYYVDGT
EVERKVTEETEEPIVECQECETEVSPSQTGGSSGDLGDISSFSSKASSSHHTSSGTSLSA
IHSSGSSGRGAGPLKGKASGTEAADFALPSSRGGPGKLSPRKGISQTGAPVCEEDGDAGL
GIRQGGKAPVTPRGRGRRGRPPSRTTGTRETVVSGPLGVEDISPSMSPDDKSFTRIMPRV
PDSTKRTDASSSTLRRSDSPEIPFQAATGSSDGLDSSSSGNSFVGLRVVAKWSSNGYFYS
GKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRK
ESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGLGPYEAVTPLTKAADISLDNLV
EGKRKRRSNISSPVTPTAASSSSTTPTRKATESPRASTGVPSGKRKLPTSEEERSPAKRG
RKSATVKPGTVGAAEFVSPCETGDNIGEPSVLEEPRGPLPLNKTLFLGYAFLLTMATTSD
KLASRSKLLDGPTGSSEEEEEFLEIPPFNKQYTECQLRAGAGYILEDFNEAQCNTAYQCL
LIADQHCRTRKYFLCLASGIPCVSHVWVHDSCHANQLQNYRNYLLPAGYSLEEQRILDWQ
PRENPFQNLKVLLVSDQQQNFLELWSEILMTGGAASVKQHHSSAHNKDIALGVFDVVVTD
PSCPASVLKCAEALQLPVVSQEWVIQCLIVGERIGFKQHPKYKHDYVSH
NT seq 5910 nt NT seq  +upstreamnt  +downstreamnt
atgccaggggagcagatggaccctactggaagtcaattggattcagatttctctcagcaa
gacactccttgcctgataatagaagattctcagcctgaaagccaggttctggaagaagat
gcaggctctcacttcagcgtgctatctcgacaccttcctaatctgcagatgcacaaagag
aaccccgtgttggatattgtatcaaatccggaacaatctgctgtagaacaaggagacagt
aatagctcattcaatgaacatctgaaagaaaagaaagcttcagatcctgtggagtcttct
catttgggtaccagtggttccatcagtcaggtcattgaacggttacctcagccaaacagg
acaagcagtgctctggcagtgacagtagaagctgcttctctcccagaggaggagaaggaa
gaagaggagttagaggaggagaaggaaggggtgggagcaaacgctcccggtgctgactcc
cttgctgctgaagattctgcttcatcacagttgggctttggagttctggaactgtcccag
agccaggatgttgaagaacatacagtgccatatgatgtcaaccaagagcatctgcagttg
gtgaccactaactcgggttctagcccgctatctgatgtggatgcgagcactgcaattaaa
tgtgaagaacagcccactgaagatattgccatgatagaacagcccagcaaagacatccct
gttacagtacagcccggtaaaggtatccatgtggtagaagaacaaaatctaccacttgta
aggtccgaagaccggccgtccagtcctcaagtttctgttgctgctgtggaaacaaaggaa
caggtacctgcccgggagctgctggaagaggggccgcaggttcagccgtcatcagagcct
gaggtttcctcaacccaggaggacttgtttgaccagagtagtaaaacagcttctgatggt
tgttctactccttcaagggaggaaggtgggtgctctccggtttccacacctgctaccacc
ctgcagctcctgcagctctctggtcagaagccccttgttcaggagagtctttccacgaat
tcctcagatcttgttgctccttcccctgatgctttccgatctaccccttttatcgttcct
agcagtcccacagagcaaggagggagaaaagatgagcccatggatatgtcagtgatacct
gtaggaggggagcctttccagaagcttcatgatgacgaagcaatggagacagaaaaaccc
cttctcccgtctcagcctgctgtgtcaccgcaagcatcaacaccagtgtctcggagcacg
ccagttttcactcctggctctcttcccatcccgtcccagcccgagttctctcatgacatt
ttcattccatcaccaagtctggaagaaccatcagatgatgtgaagaaaggtggaggttta
catagctcatctcttactgttgagtgttccaagacttcagagagtgaaccaaagaatttc
actgatgaccttgggctctccatgacaggggattcttgcaaactgatgctttctacaagt
gagtatagtcagtcctcaaagatggagagcttgggttctcccaggactgaggaagacaga
gagaacacacagattgacgatactgaacctttgtctccagttagcaattctaaacttcct
gctgacagtgagaatgtcctggtgactccatcgcaggacgaccaggtagaaatgagtcag
aatgtagataaagcaaaagaggatgaaacggaggacagaggtgactgtaaaggcagagaa
gacgcggttgctgaagatgtttgcatcgacctcacttgtgattctgggagtcaggcagtt
ccttctccagctacccgttcggaggcactttccagtgtcttagatcaggaggaagctatg
gacactaaagaacaccatccagaggaagggttttcgggatctgaagtagaagaagtccct
gagactccctgtggaagtcacagagaggagcccaaagaagaaccgatggaaagtatccca
ctgcacctttctctgactgaaacccagtctgaggcattgtgtctgcagaaggaagccccc
aaagaggaatgcccagaagctatggaagttgaaaccagtgtgattagtattgactccccc
cagaaactgcaagtacttgaccaggaattagagcataaggacccagacacctgggaagaa
gctacttctgaggactccagtgttgttatcgttgatgtgaaggagccctctcctcgagct
gatgtttcctgtgaacctttggaggaggtggagaaatgctctgactcccagtcctgggag
ggtgtggctccagaggaagaaccatgtgctgagaatagattagatactccagaagaaaag
cgtatagaatgtgatggagattcaaaagcagagaccacagaaaaggacgctgtaacagaa
gactctccacaacctcctttgccttcagtgagagacgaacctgtcagacccgatcaggag
acacagcagccccaagttcaagagaaagagagcccagtgactgtagatgcagaagtggct
gatgacaagcagctgggaccagagggcgcatgccagcagcttgagaaggcccctgcctgt
gcctcacagagtttctgtgaaagttctagtgaaactccatttcatttcactttgcctaaa
gaaggtgatattatcccaccattgactggcgcaaccccacctcttattgggcacctaaaa
ttggagcccaagagacatagtactcctattgggattagcaactatccagaaagcaccata
gcaaccagtgatgtcacatctgaaagcatggtggagatcaatgatcctctacttgggaat
gaaaaaggggattctgagtctgccccagaaatggatggaaaactgtctctgaaaatgaaa
ctggttagtcctgagacagaggccagtgaagaatctttgcaatttagcctggaaaagcct
acaactgctgagagaaaaaatggatctactgccattgcagagcctgttgccagtctccag
aagccggtgcctgtgtttggctgcatctatgaagcccagcaagagaaggaggctcaaagt
gaggctcctccctctgcacccgacagggcgaatttgctccattttccaagtgctcaagaa
gaagacaaagaaagaccagatgttaccccaaaactcaggcagagtgaacagcctgtgaag
cctgttgggcctgtcatggacgatgctgctcctgaggactcagcttctcctgtttcgcag
cagagggcctcacaggagcagagggcctcacaggagcccttcagtcctgcagaggacgtg
atggaaacagacctgctggaaggactggctgctaaccaggacagacctagtaagatgttg
atggacaggcccacccagagtaacatcgggatccagaccgtggaccattccctgtgcgcc
ccagaaactgtctcggcagcaactcagactgtgaagagtgtgtgtgagcaggggaccagt
acagcggagcagaactctgggaaacaagatgccactgtgcagactgagagggggagtgga
gagaaacctgccagtgctcccgtggacgacacagagtccctccacagccagggggaagag
gaatttgaaatgccccagcctccgcatggccatgtcttgcatcgccacatgagaaccatt
cgagaagtccgtacactcgtcacccgcgtcatcacagatgtttattatgtggatgggaca
gaagtggaaaggaaagtaacggaggagactgaagaaccaatcgtagagtgtcaggaatgt
gaaacagaagtttccccttcacagactggaggttcctctggggacctgggggacatcagc
tccttctcctccaaagcttccagctcacaccacacatccagtggaacaagtctctcagcc
atacacagcagtggcagctcagggcgaggagctgggccactcaaaggaaaagccagtggg
acagaagctgcagattttgccttacccagttcccgaggaggcccaggaaaactgagtcct
agaaaagggatcagtcagacaggggcaccggtgtgtgaggaagatggtgatgcaggcctt
ggcatcagacagggagggaaggctccagttacacctcgtgggcgtgggcgaaggggccgc
ccaccttctcggaccactggaaccagagaaacagttgtctctggtccgttgggcgtagaa
gatatttcacctagcatgtcaccagatgacaagtccttcacccgcattatgcctcgtgtg
ccagattctaccaaacggacggatgccagttctagtactttgcggcggagtgattctcca
gagattccttttcaggctgctactggttcctctgatggcttggattcctcatcttcagga
aacagctttgtgggtctccgtgttgtagctaagtggtcatccaatggctacttttactct
gggaagatcacccgagatgtgggggctgggaagtacaagctgctctttgatgatgggtac
gaatgtgacgtgctgggcaaagacattctcctgtgtgaccccatccccctggacactgaa
gtgacagccctctcagaagatgaatatttcagtgcaggagtggtgaaaggacataggaag
gagtctggggagctgtattacagcattgaaaaagaaggccaaaggaagtggtataaacga
atggcagtcattctgtccttggagcaaggaaacagactgagagagcaatatgggcttggc
ccatatgaagctgtcacaccgctcacgaaggcagcagatatcagcttagacaatttggtg
gaaggaaagcggaaacggcgcagtaacatcagctccccagtcacccccactgccgccagt
agcagcagcacaacgcccacacgtaaagccacggagagtccccgtgcttccacgggagtc
ccatcaggcaaaaggaaacttccgacttctgaagaggaacgctctcctgctaagcgaggt
cgaaagtctgccaccgtgaaacctggaacagtgggggcagcagagtttgtgagtccctgt
gagactggagacaacataggtgagccttctgtcctagaagagccaagagggcctttgccc
ctcaacaagaccttgtttctgggctatgcctttctcctcaccatggctacaactagtgac
aagctggccagtcgctctaagctgctagatggtcctacaggaagcagtgaagaagaggag
gaatttttagaaattcctcctttcaacaagcagtatacagaatgccagcttcgagcagga
gctgggtatatccttgaagacttcaatgaagcccagtgtaacacagcctaccagtgtctc
ctaattgcggaccagcactgtcgaacccggaagtacttcctgtgccttgccagtggcatt
ccttgtgtgtctcatgtctgggtccatgacagttgccatgccaaccaacttcaaaactat
cgtaattatctgctgcctgctgggtatagccttgaagagcaacgaattctggattggcaa
ccccgtgaaaaccctttccagaatctgaaggtcctcttggtgtcagatcaacaacagaac
ttcttggagctctggtctgagatccttatgactggaggggcagcctctgtgaagcagcac
cattcaagtgcccacaacaaagacattgctttaggggtatttgatgtggtggtgacagac
ccctcatgcccagcctcggtgctcaagtgtgctgaagccttgcaactgcctgtggtatca
caagaatgggtgatccagtgcctcattgttggggagagaattggattcaagcagcatcca
aaatataaacatgattatgtttctcactaa

DBGET integrated database retrieval system