KEGG   Mus musculus (mouse): 27226
Entry
27226             CDS       T01002                                 

Symbol
Pla2g7, PAF, PAF-AH, R75400
Name
(RefSeq) phospholipase A2, group VII (platelet-activating factor acetylhydrolase, plasma)
  KO
K01062  platelet-activating factor acetylhydrolase [EC:3.1.1.47]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00565  Ether lipid metabolism
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00565 Ether lipid metabolism
    27226 (Pla2g7)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.47  1-alkyl-2-acetylglycerophosphocholine esterase
     27226 (Pla2g7)
SSDB
Motif
Pfam: PAF-AH_p_II Chlorophyllase2 Peptidase_S9 Abhydrolase_1 Hydrolase_4 Abhydrolase_6 Abhydrolase_5 Chlorophyllase Abhydrolase_3 Esterase Lipase_3 Abhydrolase_2
Other DBs
NCBI-GeneID: 27226
NCBI-ProteinID: NP_038765
MGI: 1351327
Ensembl: ENSMUSG00000023913
Vega: OTTMUSG00000026307
UniProt: Q60963
Position
17; 17 B3
AA seq 440 aa
MVPLKLQALFCLLCCLPWVHPFHWQDTSSFDFRPSVMFHKLQSVMSAAGSGHSKIPKGNG
SYPVGCTDLMFGYGNESVFVRLYYPAQDQGRLDTVWIPNKEYFLGLSIFLGTPSIVGNIL
HLLYGSLTTPASWNSPLRTGEKYPLIVFSHGLGAFRTIYSAIGIGLASNGFIVATVEHRD
RSASATYFFEDQVAAKVENRSWLYLRKVKQEESESVRKEQVQQRAIECSRALSAILDIEH
GDPKENVLGSAFDMKQLKDAIDETKIALMGHSFGGATVLQALSEDQRFRCGVALDPWMYP
VNEELYSRTLQPLLFINSAKFQTPKDIAKMKKFYQPDKERKMITIKGSVHQNFDDFTFVT
GKIIGNKLTLKGEIDSRVAIDLTNKASMAFLQKHLGLQKDFDQWDPLVEGDDENLIPGSP
FDAVTQVPAQQHSPGSQTQN
NT seq 1323 nt   +upstreamnt  +downstreamnt
atggtaccactcaaactgcaggcgcttttctgcctcctctgctgcctcccatgggtccat
ccttttcactggcaagacacatcttcttttgacttcaggccgtcagtaatgtttcacaag
ctccaatcggtgatgtctgctgccggctctggccatagtaaaatccccaaaggaaatgga
tcgtaccccgtcggttgtacagatctgatgttcggttatgggaatgagagcgtcttcgtg
cgtttgtactacccagctcaagatcaaggtcgcctcgacactgtttggatcccaaacaaa
gaatattttttgggtcttagtatatttcttggaacacccagtattgtaggcaatatttta
cacctcttatatggttctctgacaactcctgcaagctggaattctcctttgaggactgga
gaaaaatacccactcattgtcttttctcatggtctcggagccttcaggacgatttattct
gctattggcattggcttggcatctaatgggtttatagtggccactgtcgaacacagagac
agatctgcatcggcaacttacttttttgaagaccaggtggctgcaaaagtggaaaacagg
tcttggctttacctgagaaaagtaaaacaagaggagtcggaaagtgtccggaaagaacag
gttcagcaaagagcaatagaatgttcccgggctctcagtgcgattcttgacattgaacat
ggagacccaaaagagaatgtactaggttcagcttttgacatgaaacagctgaaggatgct
attgatgagactaaaatagctttgatgggacattcttttggaggagcaacagttcttcaa
gcccttagtgaggaccagagattcagatgtggagttgctcttgatccatggatgtatccg
gtgaacgaagagctgtactccagaaccctccagcctctcctctttatcaactctgccaaa
ttccagactccaaaggacatcgcaaaaatgaaaaagttctaccagcctgacaaggaaagg
aaaatgattacaatcaagggctcagtgcaccagaactttgacgactttacttttgtaact
ggcaaaataattggaaacaagctgacactgaaaggagaaatcgattccagagtagccatc
gacctcaccaacaaagcttcgatggctttcttacaaaagcatttagggcttcagaaagac
tttgatcagtgggaccctctggtggaaggagatgatgagaacctgattcctgggtcaccc
tttgacgcagtcacccaggtcccggctcagcaacactctccaggatcacagacccagaat
tag

DBGET integrated database retrieval system