KEGG   Mus musculus (house mouse): 272411
Entry
272411            CDS       T01002                                 
Symbol
B3gnt6, BC039789, Core-3, Core3
Name
(RefSeq) UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 6 (core 3 synthase)
  KO
K00739  acetylgalactosaminyl-O-glycosyl-glycoprotein beta-1,3-N-acetylglucosaminyltransferase [EC:2.4.1.147]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00512  Mucin type O-glycan biosynthesis
mmu01100  Metabolic pathways
Module
mmu_M00056  O-glycan biosynthesis, mucin type core
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    272411 (B3gnt6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mmu01003]
    272411 (B3gnt6)
Enzymes [BR:mmu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.147  acetylgalactosaminyl-O-glycosyl-glycoprotein beta-1,3-N-acetylglucosaminyltransferase
     272411 (B3gnt6)
Glycosyltransferases [BR:mmu01003]
 Glycan extension
  Type 2 chain/Poly-N-acetyllactosamine
   272411 (B3gnt6)
SSDB
Motif
Pfam: Galactosyl_T Fringe
Other DBs
NCBI-GeneID: 272411
NCBI-ProteinID: NP_001074636
MGI: 3039603
Ensembl: ENSMUSG00000074004
UniProt: Q3USF0
Position
7:complement(97841622..97848682)
AA seq 391 aa
MALPSSRRFKSPTTLAFFLVGVTLVVLNQWFLQEHRQEKAKGPVATRRSLAAVVQRSPLF
QVPPCVANASANLLTGFQLLPARIQDFLRYRHCRRFPQLWDAPPKCAGPRGVFLLLAVKS
SPAHYERRELIRRTWGQERSYSGRQVLRLFLVGTSPPEEAAREPQLADLLSLEAREYGDV
LQWDFSDTFLNLTLKHLHLLDWTAEHCPGVSFLLSCDDDVFVHTANVLSFLEVQSPEHHL
FTGQLMVGSVPVRESGSKYFVPPQIFPGVAYPAYCSGGGFLLSRYTVRNLRSAAHHVPLF
PIDDAYMGMCLQQAGLAPSSHQGIRPFGVQLPNVQRLSLDPCMYRELLLVHRFAPYEMLL
MWKALHNPALHCSHKQVAGSPTAGEQNPDAH
NT seq 1176 nt   +upstreamnt  +downstreamnt
atggctttgcccagcagccgcaggttcaagagtcccacgacactggctttctttctagtg
ggtgtgactttagtggtgctgaatcagtggttcctccaggaacacaggcaggagaaagcc
aagggtcctgtggccactcgccggtctttggcagctgtggtacagcgttcgccgctcttc
caggtgcccccctgcgtggccaacgcctccgcgaacctcctgactggcttccagctgctg
cctgctaggatccaagacttcctgcgctaccgccactgccgccgctttccgcaactgtgg
gacgcgccgcccaagtgcgcgggcccccgcggcgtcttcttgctgctggccgtgaagtcg
tcgcctgcgcactacgagcggcgcgagctgatccggcgcacgtggggccaggagcgcagc
tacagcggccggcaggtgcttcgcctcttcctggtggggacctcccctcccgaggaggcg
gctcgcgagcctcagctggccgatctgctgagcctggaggcgcgcgagtacggcgatgtg
ctgcagtgggacttcagtgacaccttcctcaacctcacactcaagcacctgcacctgctg
gactggacagcggagcactgcccgggcgtgagcttcctgctcagctgcgacgacgacgtc
ttcgtgcacacggccaacgtactgagcttcctagaggtgcagtcgcccgagcaccacctc
ttcaccgggcagctcatggttggttctgtgcctgttcgcgaaagcgggagcaagtacttc
gtgcccccacagatcttcccgggcgtagcctaccctgcgtactgcagcggcggcggcttc
cttctgtcccgctacacagtccgcaacctgcgcagcgcggcacaccacgtcccgctcttc
cccatcgacgatgcctacatgggcatgtgtctgcagcaggccggcctggcgcccagcagc
caccagggcatccggcccttcggcgtgcagctgcccaatgtgcagcgcttatccttggat
ccctgcatgtaccgcgagctgctgctggtgcaccgcttcgcgccttatgagatgctgctc
atgtggaaggcgctgcacaacccagcgctgcactgtagccacaaacaggttgcaggatct
cccacggccggagaacagaaccccgatgcacactga

DBGET integrated database retrieval system