KEGG   Mus musculus (mouse): 27355
Entry
27355             CDS       T01002                                 

Gene name
Pald1, MMPAL, Pald, mKIAA1274, p
Definition
(RefSeq) phosphatase domain containing, paladin 1
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: PTPlike_phytase
Other DBs
NCBI-GeneID: 27355
NCBI-ProteinID: NP_038781
MGI: 1351623
Ensembl: ENSMUSG00000020092
UniProt: P70261 A0A0R4J007
Position
10; 10 B4
AA seq 859 aa
MGTTASTAQQTVSAGTSLEGLQGGSSSSMDSQHSLGGVQSFRATSLHNSKAKSIIPNKVA
PVVITYNCKEEFQIHDELLKAHYRMGRLSDATPEHYLVQGRYFLVRDITEKMDILGTLKS
CGAPNFRQVRGGLPVFGMGQPSLLGFRRVLQKLQTDGLKECIIFCVREEPVVFLRAEEDF
VSYTPRDKESLHENLRDPSPGVKAENLELAIQKEIHDFAQLRDNVYHVYHNTEDLRGEPH
TVAIRGEDGVCVTEEVFKRPLFLQPTYRYHRLPLPEQGAPLEAQFDAFVSVLRETPSLLP
LRDNHGPLPALLFSCQSGVGRTNLGMVLGTLVMFHHSRTTSQLEAASPLAKPLPMEQFQV
IQGFICKVPQGKKMVEEVDRAISACAELHDLKEEVLKNQRRLESFRPESRGQECGSQQAV
QQRALWSLELYFYLLLFNYYLHEQYPLAFALSFSRWLCTHPELYRLLVELNSVGPLVPGD
LIAKGSLEADDLVSLDALSTVREMDVANFRRVPRMPIYGTAQPSAKALGNILAYLSDAKR
KLRQVVWINLREEVVLECDGHTHSLWPPGPALAPEHLEALEAQLKAHLSAPVPNTKSPTA
PRFQKCLTTQEVFSQHQGACLGLTYCRIPVPDFCAPREEDFDRLLEALRAALTKDPGTGF
VFSCLSGQGRTTTAMVVAVLACWHIGGCPEVGEEELVSVPDAKFTKGEFQVVMKVVQLLP
DGHHVKKEVDAALDIVSETMTPMHYHLREIIISTYRQAKATKEAQEAQRLQLRSLQYLER
YIYLILFNAYLRLEKTSSWQRPFSTWMREVATKAGIYEILNQLGFPELESIEEQPLSRLR
YRWQEQSRDPEPCDVGDFL
NT seq 2580 nt   +upstreamnt  +downstreamnt
atgggtacaacggcaagcacagcacagcagacagtctcggctggcacgtccttggagggc
ctgcagggtggcagcagcagcagcatggacagccagcattctcttggtggcgtgcagtcc
ttccgtgccacaagtttacacaacagcaaggccaagtccatcatccccaacaaggtggcc
cctgttgtgatcacgtacaactgcaaggaggagttccagatccacgatgagctgctcaag
gcccattacaggatgggccggctctcggatgccacccccgagcactacctggtgcagggt
cgctatttcttggtgcgtgacatcaccgagaagatggacatactgggcaccttgaagagc
tgtggggctcccaacttccggcaggtgcggggaggcctccctgtgtttggcatgggacag
cccagcctcttggggttcaggagggtcctgcagaaactccagacggacggactcaaggag
tgcattatcttctgcgtgcgggaggagcctgtggtgttcttgcgcgctgaggaggacttt
gtgtcttacacacctcgagacaaggagagccttcatgagaacctcagggaccctagtcca
ggggtcaaggctgagaatctggagctggccatccagaaagagatccatgactttgcccaa
ttgagagataatgtgtaccacgtataccacaacacagaggacctgcgcggggagccgcac
accgtggccatccgaggtgaggatggcgtgtgcgtgaccgaggaggtgtttaagcggccg
ctcttcctgcagcccacctacagataccaccgcctccccttgccagagcaaggggccccc
ctggaagcccagtttgatgcctttgtcagcgttcttcgggagacccccagccttctgcca
ctcagagataaccacgggcctctgcctgccctcctgttcagctgccagtcaggtgtaggc
agaaccaacctaggcatggtcctgggaaccctcgtcatgttccaccacagtaggaccacc
tcccagctagaggcagcctccccgttggccaaacccctgcccatggagcagtttcaggtg
atccagggcttcatctgtaaggtgccacaggggaagaaaatggtggaggaggtggatcga
gcgatcagtgcctgtgcagagttgcatgacctgaaggaggaggtcctaaaaaaccagagg
aggctggaaagcttcaggccagagagccggggacaggaatgtggtagtcagcaagctgtc
cagcagagggcgctgtggagcctggagctgtacttctatctgctcctatttaactactat
ctgcatgagcagtaccccctggcctttgccctcagtttcagtcgatggctgtgtacccat
cctgagctgtaccgtctgctggtggagctgaattcagtggggcccttggtccctggggac
ctcatcgccaagggctccctggaagcagatgatcttgtgtccctggatgcacttagcacc
gtcagagagatggacgtggccaacttccggcgtgtacctcgaatgcctatctatggcacc
gcacagcctagtgccaaggccttaggcaacatcctggcttacctgtctgacgccaagagg
aagcttcggcaggtggtctggatcaacctgagggaggaggttgtgttagagtgtgacggt
cacacgcacagcttgtggcctcccggaccagccctggcccctgagcatctggaggctctg
gaggcccagctgaaggcccacctgagcgcacctgtccccaacaccaagagccctactgcc
cccaggttccagaagtgcctgaccacacaggaggtcttcagccagcaccagggggcctgc
cttggccttacctactgccgtatccctgtgccagacttctgcgcccctcgggaggaggac
tttgaccggctgcttgaggccctgcgagctgctctcaccaaggacccgggcacaggcttt
gtcttcagctgcctcagtggccagggccggaccacaactgccatggtggtagccgtgctg
gcctgctggcacattgggggctgtcctgaggtgggcgaggaggagctagtgagcgtgcct
gatgccaagttcaccaaaggcgagtttcaggtggtgatgaaggtggtacagctgctgccc
gacggccaccacgtgaagaaggaggtggatgcggcgttggacattgtcagcgagactatg
acacctatgcactaccaccttcgggagatcatcatatccacctaccgacaggcaaaggct
accaaagaggcacaggaagctcagaggttgcagctgcggagcctgcagtacctggagcgc
tacatctacctgatcctctttaatgcctaccttcgcttggagaagaccagctcctggcag
aggcctttcagcacctggatgcgggaggtggcaaccaaagctggcatctatgagatcctc
aaccagctgggcttccctgagctggagagcatcgaagagcagcccctgtcgaggctccgc
taccgctggcaggagcagagtcgagacccagagccctgtgatgttggggacttcctgtag

DBGET integrated database retrieval system