KEGG   Mus musculus (mouse): 27360
Entry
27360             CDS       T01002                                 

Gene name
Add3, AI463285, R75380
Definition
(RefSeq) adducin 3 (gamma)
  KO
K18622  adducin
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    27360 (Add3)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     27360 (Add3)
SSDB
Motif
Pfam: Aldolase_II
Other DBs
NCBI-GeneID: 27360
NCBI-ProteinID: NP_001157571
MGI: 1351615
Ensembl: ENSMUSG00000025026
UniProt: Q9QYB5
Position
19 D2; 19 47.18 cM
AA seq 706 aa
MSSDTSPAVVTTPPPPSMPHKERYFDRINESDPEYLRERNMSPDLRQDFNMMEQRKRVTQ
ILQSPAFREDLECLIQEQMKKGHNPSGLLALQQIADYIVTSSFSGFSSPSLSLGMVTPIN
DLPGADTSSYVKGEKLTRCKLASLYRLADLFGWAHLANTYISVRISKEQDHIIIIPRGLS
FSEATASTLVKVNIIGEVVDQGSTDLKIDHTGFSPHAAIYSTRPDVKCVIHIHTLATAAV
SSMKCGILPISQESLILGDVAYYDYQGSLDEEEERIELQKVLGPSCKVLVLRNHGMVALG
ETLEEAFHYIFNVQMACEIQVQAVAGAGGVDNLLVLDLQKYKAFTHGVAMSGGGGVNMAS
HQKWKVGEIEFEGLMRTLDNLGYRTGYAYRHPLVREKPRHKSDVEIPATVTAFSFEDDSA
PLSPLKFMAQRQQREKTRWLNSPNTYMKVNVPEESRNGETSPRTKITWMKAEDSSKVSSG
TPIKIEDPNQFVPLNTNPTEVLEKRNKIREQNRYDLKTAGPQSQLLAGIVVDKPPSTMQF
DDDDQGPPAPPNPFSHLLEGELEEYTKTIERKQQGLDDAEQGSLSDDAASVSQIQSQTQS
PQSVPERLEENHELFSKSFTSMDAPVMIMNGKDEMHDVEDELAQRVSRLTTSTTIENIEI
TIKSPERTEEVLSPDGSPSKSPSKKKKKFRTPSFLKKNKKKEKVEA
NT seq 2121 nt   +upstreamnt  +downstreamnt
atgagttccgacaccagcccagctgtggttaccacgcctcctcctcccagcatgcctcac
aaagagaggtattttgaccgaatcaatgaaagtgatccggaataccttcgagagaggaac
atgtctcctgatctacgacaggacttcaatatgatggagcagaggaagcgagtcactcag
atcctgcagagccctgcctttcgggaagacctggaatgcctcatccaagagcagatgaag
aaaggccacaacccaagcggcttattagcgttacagcagattgcggattacatcgtgacc
agctccttctcgggcttctcctcgccctccctgagtcttggcatggtcacacctattaat
gaccttcctggtgcagatacatcctcgtatgtgaagggagaaaagcttactcgctgcaaa
cttgccagcctctacaggcttgcagacttgtttgggtgggcgcacctggcaaatacgtac
atctcggtacgaataagtaaggagcaagaccacattataataattcccagaggcctctct
ttttctgaagcgacagcctccactttggtgaaagtcaacataatcggagaagtggtggac
caggggagcactgatctgaaaatcgaccacacgggcttcagcccgcatgctgccatctat
tcaacacgccccgatgtgaagtgtgtgatccacatccacacccttgccacagcagcggtg
tcctccatgaagtgtgggatccttccaatttcccaagagtctctcatcctgggagatgtc
gcctactatgactaccaggggtcgcttgatgaggaggaagaaagaattgaacttcagaaa
gtgctgggtccaagctgtaaggtgctcgtcctcaggaaccatggcatggtggctcttggc
gagaccctcgaggaggctttccattacatctttaatgtacagatggcctgtgagatccag
gtgcaggcagtagcaggggcaggcggagtagacaatctgctcgtactggatcttcagaaa
tataaagctttcacccacggtgtcgccatgtctggaggaggcggtgtaaacatggcttcc
catcagaagtggaaggttggcgagattgagtttgaagggctgatgaggaccctggacaac
ttgggctacagaacaggctatgcgtacaggcatcctctggtccgagagaagcctaggcac
aagagtgacgtggagatccctgcaaccgtgactgccttctcctttgaagatgacagtgct
ccactctctcccctcaagttcatggcacagagacagcagcgtgaaaaaacaagatggctg
aattcaccaaatacttacatgaaggtgaatgtgccggaggagtctcggaacggggaaact
agtcccaggaccaaaatcacgtggatgaaagcagaagactcctctaaagtcagtagtggg
acaccgatcaaaattgaagaccccaatcagtttgttcctttaaacacaaacccgacggag
gtgctagaaaagagaaataagatccgggaacagaatcgctatgatctgaagacagcaggg
ccgcagtctcagctgctggcggggatcgttgtggacaagccgccttcgaccatgcagttt
gacgatgacgatcagggcccaccagctcctcctaacccattcagccacctcctggaagga
gaactggaagagtatacgaagacaatcgagagaaagcagcaaggcctggacgacgctgag
caggggtcactctcagacgacgctgcatctgtttcacaaattcagtctcaaactcagtca
ccgcagagtgtccctgagagattagaagaaaaccacgagctgttttccaagagcttcacc
tccatggacgcgcctgtcatgatcatgaacggcaaggacgagatgcatgatgtcgaagac
gagcttgctcagcgagtcagtaggctgaccacaagcacgaccatagagaacatcgagatc
accattaagtccccagaaagaactgaagaggtcctgtcgcctgatggctcaccttcaaag
tcgccctccaagaaaaagaagaaattccgcacgccttcttttctcaaaaagaacaaaaaa
aaggagaaagttgaggcctaa

DBGET integrated database retrieval system