KEGG   Mus musculus (mouse): 27364
Entry
27364             CDS       T01002                                 

Symbol
Srr, M100034, Rgsc34, Srs
Name
(RefSeq) serine racemase
  KO
K12235  serine racemase [EC:5.1.1.18]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00260  Glycine, serine and threonine metabolism
mmu00470  D-Amino acid metabolism
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    27364 (Srr)
  09106 Metabolism of other amino acids
   00470 D-Amino acid metabolism
    27364 (Srr)
Enzymes [BR:mmu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.18  serine racemase
     27364 (Srr)
SSDB
Motif
Pfam: PALP
Other DBs
NCBI-GeneID: 27364
NCBI-ProteinID: NP_001156783
MGI: 1351636
Ensembl: ENSMUSG00000001323
Vega: OTTMUSG00000006189
UniProt: Q9QZX7
Position
11:complement(74794853..74818427)
AA seq 339 aa
MCAQYCISFADVEKAHINIQDSIHLTPVLTSSILNQIAGRNLFFKCELFQKTGSFKIRGA
LNAIRGLIPDTPEEKPKAVVTHSSGNHGQALTYAAKLEGIPAYIVVPQTAPNCKKLAIQA
YGASIVYCDPSDESREKVTQRIMQETEGILVHPNQEPAVIAGQGTIALEVLNQVPLVDAL
VVPVGGGGMVAGIAITIKALKPSVKVYAAEPSNADDCYQSKLKGELTPNLHPPETIADGV
KSSIGLNTWPIIRDLVDDVFTVTEDEIKYATQLVWGRMKLLIEPTAGVALAAVLSQHFQT
VSPEVKNVCIVLSGGNVDLTSLNWVGQAERPAPYQTVSV
NT seq 1020 nt   +upstreamnt  +downstreamnt
atgtgtgctcagtactgcatctcctttgctgatgttgaaaaagctcatatcaacattcaa
gactctatccacctcaccccagtgctaacaagctccattttgaatcaaatagcagggcgc
aatcttttcttcaaatgtgagctcttccagaaaactgggtcttttaagattcgaggtgcc
cttaatgccatcagaggcttaattcctgacacgccagaagagaagcccaaagccgtagtt
actcacagcagcggaaaccatggccaagctctcacctatgctgctaaactggaaggaatt
cctgcttacattgtggttccccaaacagctcccaactgcaagaaactggcaatccaagcc
tatggagcatcgatagtatactgtgacccaagtgacgagtccagagaaaaggtcactcaa
agaattatgcaagaaacagaaggcatcttggtccatcccaaccaggagcctgcagtgata
gctggacaaggaacaattgccctggaagtgctgaaccaggttcccttggtagatgcactg
gtggtaccagtaggaggaggaggaatggttgctggaatagccattacaattaaggccctg
aaacctagtgtgaaggtatacgctgctgagccctcgaatgcagatgactgctaccagtct
aaactgaaaggagaactgacccccaatcttcatcctccagaaaccatagcagatggtgtc
aaatccagcattggcttgaatacctggcctattataagagaccttgtggatgatgtcttc
actgtcaccgaagatgaaatcaagtatgcaacccagctggtgtgggggagaatgaaactg
ctcattgagccgactgctggcgtggcactggctgcagtgctgtctcagcatttccaaaca
gtctctccagaagtaaagaacgtctgcattgtactcagtggggggaatgtagacctaacc
tccctgaactgggtggggcaggctgaacggccagctccttaccagacggtttctgtttaa

DBGET integrated database retrieval system