KEGG   Mus musculus (mouse): 27371
Entry
27371             CDS       T01002                                 

Gene name
Sh2d2a, L, Lad, R, Ribp, TS, Tsad
Definition
(RefSeq) SH2 domain containing 2A
  KO
K08273  SH2 domain-containing protein 2A
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04370  VEGF signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    27371 (Sh2d2a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    27371 (Sh2d2a)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 Src homology (SH) domain-containing proteins
  Other SH2 and SH3-containing proteins
   27371 (Sh2d2a)
SSDB
Motif
Pfam: SH2
Other DBs
NCBI-GeneID: 27371
NCBI-ProteinID: NP_067284
MGI: 1351596
Ensembl: ENSMUSG00000028071
Vega: OTTMUSG00000051868
UniProt: Q9QXK9 Q5D0E4
Position
3 F1; 3 38.78 cM
AA seq 374 aa
MEFCLAQPCPQGNHEATSSTFNTFQPMNLTQGRCQNLSCGSRPSMQVMKEQGVQLSPRTN
HTVVSASAPGTAWVLGNADRAEEVPGKGDLSLQAETRAWVQKTQAHWLLLKTAPLWFHGF
ITRREAERLLQPQPLGCYLVRFSESAVTFVLSYRSQTCCRHFLLAQLGDGRHVVLGEDSA
HAQLQDLLEHYTECPLSPYGEILTQPLARQTAEPAGLSLRADSDSGSKRQDPDTQLSLLL
QQGQAQASGHTEKVWASQQKATSQASRPRPPIPAKPQLPPEVYTSPASRLHQAPPINPIY
QEPDEPIAFYAMGRGSPGDAPSNIYAEVEGPSGTAPIGHPILRKCWSRPISRGQVREVQG
KISSRSRAERGSPS
NT seq 1125 nt   +upstreamnt  +downstreamnt
atggagttctgcttggcccaaccatgcccccaagggaatcatgaagctacttcatcaacc
ttcaacaccttccagccaatgaacctgacccaggggagatgccagaacttgagttgtggg
agcaggcccagcatgcaagttatgaaggaacagggggttcagctcagccccagaactaac
cacacggtggtctctgcctcagccccaggaactgcctgggtcctagggaatgccgatagg
gcagaagaggtgcctgggaaaggtgacctgtcattgcaagctgagaccagagcatgggtc
cagaagacccaggcccactggctcttgctcaagactgcccctctttggttccatggcttc
atcaccagaagggaagccgagaggctgctgcagccccagcctctaggatgctatctggtg
cgcttcagcgagagtgctgtgaccttcgtgctgtcctacaggagccagacctgctgccgt
cacttcctcctcgcgcagctaggggatgggcgccacgtggtgctaggtgaagacagtgcc
catgcgcagcttcaggacctgcttgaacattacacagagtgccccctcagcccctacgga
gagatactcacccaacccctcgctcgacagacagctgagcctgctggactttccctaagg
gctgattcagactctggaagcaaaagacaggacccagacacccagctcagcctgctcctc
caacagggccaggcccaggcctcaggacacacagagaaagtatgggcctcccaacagaag
gcgacatcccaggcatccagacccaggccgcccatccccgccaagcctcagcttcctcct
gaagtctatacaagtcctgcttcacgactgcatcaggccccacccattaaccccatctac
caggagcctgatgaacccatagccttctatgccatggggcggggcagccctggggacgct
cctagtaatatctatgctgaggtggaagggccatcgggaacggcgcccattggacacccc
atcctccgaaagtgctggtccaggcctatctcaagaggccaggtaagggaggtacaggga
aagataagctcaaggagtcgagcagaaagagggagcccctcctga

DBGET integrated database retrieval system