KEGG   Mus musculus (mouse): 27374
Entry
27374             CDS       T01002                                 

Gene name
Prmt5, Jbp1, Skb1
Definition
(RefSeq) protein arginine N-methyltransferase 5
  KO
K02516  type II protein arginine methyltransferase [EC:2.1.1.320]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03013  RNA transport
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    27374 (Prmt5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mmu03041]
    27374 (Prmt5)
   03036 Chromosome and associated proteins [BR:mmu03036]
    27374 (Prmt5)
Enzymes [BR:mmu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.320  type II protein arginine methyltransferase
     27374 (Prmt5)
Spliceosome [BR:mmu03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    27374 (Prmt5)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    PRMTs (protein arginine metyltransferases)
     27374 (Prmt5)
SSDB
Motif
Pfam: PRMT5_TIM PRMT5 PRMT5_C MTS Met_10
Other DBs
NCBI-GeneID: 27374
NCBI-ProteinID: NP_038796
MGI: 1351645
Ensembl: ENSMUSG00000023110
Vega: OTTMUSG00000020079
UniProt: Q8CIG8 A0A0R4J049
Position
14; 14 C2
AA seq 637 aa
MAAMAVGGAGGSRVSSGRDLNCVPEIADTLGAVAKQGFDFLCMPVFHPRFKREFIQEPAK
NRPGPQTRSDLLLSGRDWNTLIVGKLSPWIHPDSKVEKIRRNSEAAMLQELNFGAYLGLP
AFLLPLNQEDNTNLARVLTNHIHTGHHSSMFWMRVPLVAPEDLRDDVIENAPTTHTEEYS
GEEKTWMWWHNFRTLCDYSKRIAVALEIGADLPSNHVIDRWLGEPIKAAILPTSIFLTNK
KGFPVLSKVQQRLIFRLLKLEVQFIITGTNHHSEKEFCSYLQYLEYLSQNRPPPNAYELF
AKGYEDYLQSPLQPLMDNLESQTYEVFEKDPIKYSQYQQAIYKCLLDRVPEEEKETNVQV
LMVLGAGRGPLVNASLRAAKQAERRIRLYAVEKNPNAVVTLENWQFEEWGSQVTVVSSDM
REWVAPEKADIIVSELLGSFADNELSPECLDGAQHFLKDDGVSIPGEYTSFLAPISSSKL
YNEVRACREKDRDPEAQFEMPYVVRLHNFHQLSAPKPCFTFSHPNRDPMIDNNRYCTLEF
PVEVNTVLHGFAGYFETVLYRDITLSIRPETHSPGMFSWFPIFFPIKQPITVHEGQNICV
RFWRCSNSKKVWYEWAVTAPVCSSIHNPTGRSYTIGL
NT seq 1914 nt   +upstreamnt  +downstreamnt
atggcggcgatggcagtcggaggtgctggtggcagccgcgtgtccagcgggagggacctg
aattgcgtccccgaaatagctgacacactgggtgctgtggccaagcaggggtttgatttc
ctctgcatgcctgtcttccacccgcgtttcaagagggagttcattcaggaacctgctaag
aatcggcctggcccccagacacgatcagacctactgctgtcaggaagggactggaatacg
ctaattgtgggaaagctttctccatggattcatccagactcaaaagtggagaagatccga
aggaactctgaagcggctatgttacaggagttgaattttggggcatatctgggtcttcca
gctttcctattgccccttaatcaggaagataacacgaatctggccagagttctgaccaac
cacatccacactggccaccactcttccatgttctggatgagggtacccttggtggcccca
gaggacctgagagatgatgtaattgagaatgccccgactacacacacagaggagtacagt
ggagaagagaaaacatggatgtggtggcataactttcggactctgtgtgactatagcaag
agaattgcagtagctcttgaaattggagctgacctcccgtctaatcacgtcattgaccgc
tggcttggagagcccatcaaagcagccattctccccaccagcattttcctaaccaacaag
aaaggatttcctgttctttctaaggtgcagcagaggctgatcttccggctcctcaagttg
gaagtgcagtttatcatcacgggaaccaaccaccactcagagaaggagttctgttcctac
ctccagtacttggaatacttaagccaaaatcgccctccacccaatgcctatgagctcttt
gccaaaggctatgaagactatctgcagtccccactccagcctctgatggacaatctggaa
tctcagacatatgaagtgtttgaaaaggaccccatcaaatactctcaatatcagcaggct
atttataaatgtttgctagaccgagtaccagaagaagaaaaggagaccaatgtccaggta
cttatggtgctgggtgcaggccggggtcctcttgtgaatgcgtctcttcgggcagccaaa
caggccgagcggcggatcaggctgtatgctgtggagaagaaccccaatgctgtggtgacg
ctagagaactggcagtttgaagaatgggggagccaggtgacagttgtctcatcagacatg
cgggaatgggtggctccggagaaagctgacatcattgtcagtgagcttctgggttccttt
gccgacaacgagctgtcacctgagtgtctggatggagcacagcacttcctgaaagatgat
ggcgtgagcatccctggagaatacacctccttcctggctcccatttcttcctctaagctg
tacaatgaggtccgtgcctgtcgggaaaaggaccgcgatcctgaggcacagtttgagatg
ccttatgtggttcggttgcacaacttccaccagctctctgctcctaagccctgctttacc
ttcagccatcccaaccgagatcctatgattgacaacaaccgctactgtaccttggagttt
cctgtggaggtgaacacagtgcttcatggcttcgcaggctactttgagactgtgctttac
cgggacatcactctgagtatccgcccagagactcactctcctgggatgttctcatggttc
cccatcttcttccccattaagcagcccatcacggtgcacgaaggccagaacatctgtgtg
cgtttctggcgatgcagcaattccaagaaagtgtggtacgagtgggcggtgacggccccc
gtctgttcttctattcacaaccctaccggccgctcctataccattggcctctag

DBGET integrated database retrieval system