KEGG   Mus musculus (mouse): 27384Help
Entry
27384             CDS       T01002                                 

Gene name
Akr1c13, mKIAA4014
Definition
(RefSeq) aldo-keto reductase family 1, member C13
  KO
K13374  aldo-keto reductase family 1 member C13 [EC:1.1.1.218]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    27384 (Akr1c13)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.218  morphine 6-dehydrogenase
     27384 (Akr1c13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldo_ket_red
Motif
Other DBs
NCBI-GeneID: 27384
NCBI-ProteinID: NP_038806
MGI: 1351662
Ensembl: ENSMUSG00000021213
Vega: OTTMUSG00000027949
UniProt: Q8VC28 Q571M4
Structure
PDB: 

Position
13; 13 A1
AA seq 323 aa AA seqDB search
MSSKQHCVKLNDGHLIPALGFGTYKPKEVPKSKSLEAACLALDVGYRHVDTAYAYQVEEE
IGQAIQSKIKAGVVKREDLFITTKLWCTCFRPELVKPALEKSLKKLQLDYVDLYIMHYPV
PMKSGDNDFPVNEQGKSLLDTVDFCDTWERLEECKDAGLVKSIGVSNFNHRQLERILNKP
GLKYKPVCNQVECHLYLNQRKLLDYCESKDIVLVAYGALGTQRYKEWVDQNSPVLLNDPV
LCDVAKKNKRSPALIALRYLIQRGIVPLAQSFKENEMRENLQVFGFQLSPEDMKTLDGLN
KNFRYLPAEFLVDHPEYPFVEEY
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgagctccaaacagcactgtgtcaaactaaatgatggccacttaattcctgccctgggc
tttggcacctataaacccaaggaggttcccaagagtaagtcactggaggctgcatgccta
gctctagatgttgggtaccgccatgttgatactgcttatgcataccaagtagaagaggag
ataggacaggccattcaaagcaagattaaagctggggttgtaaagagagaagacctgttc
atcactacaaagctttggtgcacttgctttcgaccagagctggtcaagcctgccttggaa
aagtcactgaaaaagcttcagctggattatgttgatctttacattatgcattacccagtg
ccaatgaagtcaggggataatgattttccagtaaatgagcaagggaaatctctgttggac
actgtggatttctgtgacacatgggagaggttggaggagtgtaaggatgcaggattggtc
aagtccattggggtgtccaactttaaccacaggcagctggagcgaatcctcaataagcca
ggactgaagtacaaacctgtctgcaaccaggttgaatgtcatctctatttgaaccagcgt
aagctactggattactgcgaatcaaaagacattgttctcgttgcttacggtgctctgggg
acccagcgatataaagaatgggtggaccagaactccccagttctcttgaatgatccagtt
ctttgtgatgtggccaaaaagaacaagcgaagtcctgccttgattgcacttcgatacctg
attcaacgtgggattgtgcccctggcccagagtttcaaagagaatgagatgagagagaat
ttgcaggtttttggatttcagttgtcccctgaggacatgaaaacactagatggcctgaac
aaaaactttcgataccttccagcagagttccttgttgaccacccagagtatccatttgtg
gaggaatattaa

DBGET integrated database retrieval system