KEGG   Mus musculus (mouse): 27397
Entry
27397             CDS       T01002                                 

Gene name
Mrpl17, MRP-L26, Rpml26
Definition
(RefSeq) mitochondrial ribosomal protein L17
  KO
K02879  large subunit ribosomal protein L17
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03010  Ribosome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    27397 (Mrpl17)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:mmu03011]
    27397 (Mrpl17)
Ribosome [BR:mmu03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    27397 (Mrpl17)
  Bacteria
    27397 (Mrpl17)
SSDB
Motif
Pfam: Ribosomal_L17
Other DBs
NCBI-GeneID: 27397
NCBI-ProteinID: NP_079577
MGI: 1351608
Ensembl: ENSMUSG00000030879
Vega: OTTMUSG00000025496
UniProt: Q9D8P4
Position
7; 7 E3
AA seq 176 aa
MRLSLAAAISHGRVYRRLGLGPESRIHLLRNLLTGLVRHERIEATWARADEMRGYAEKLI
DYGKLGDTNERAMRMADFWLTEKDLIPKLFKVLAPRFQGQNGNYTRMLQIPNRKEQDRAK
MAVIEYKGNYLPPLPLPHRDSNLTLLNQLLLGLQQDLHHNQDASLHSSCTVQTPKT
NT seq 531 nt   +upstreamnt  +downstreamnt
atgaggttgtcgctggctgccgctatctcccacggccgcgtctaccgccgcctgggcctg
ggtccggagtcccgcatccatctgctgcggaacttgctcacgggcctagttcgccacgaa
cgcatcgaggcgacatgggcacgcgcggacgagatgaggggctacgcggagaagctcatc
gattatggaaagctgggcgacaccaacgaacgagccatgcgtatggctgacttctggctc
acagagaaggacttgatcccaaagctgtttaaagtgctagcgcctcggttccaaggtcag
aatgggaactacacaagaatgctacagatcccgaatcggaaggagcaagatcgggccaag
atggcggtgatagaatataaagggaactacctccctcccctgcctctgcctcacagagac
agcaaccttactctcctaaaccagctgctcctgggactgcagcaggacctgcaccataac
caggacgcaagcctccacagctcctgtacagttcaaacaccaaagacttaa

DBGET integrated database retrieval system