KEGG   Mus musculus (mouse): 27398
Entry
27398             CDS       T01002                                 

Gene name
Mrpl2, CGI-2, CGI-22, L2mt, MRP-, MRP-L14, MRP-L2, Rpm, Rpml14
Definition
(RefSeq) mitochondrial ribosomal protein L2
  KO
K02886  large subunit ribosomal protein L2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03010  Ribosome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    27398 (Mrpl2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:mmu03011]
    27398 (Mrpl2)
Ribosome [BR:mmu03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    27398 (Mrpl2)
  Bacteria
    27398 (Mrpl2)
  Archaea
    27398 (Mrpl2)
SSDB
Motif
Pfam: Ribosomal_L2_C Ribosomal_L2
Other DBs
NCBI-GeneID: 27398
NCBI-ProteinID: NP_079578
MGI: 1351622
Ensembl: ENSMUSG00000002767
Vega: OTTMUSG00000024284
UniProt: Q9D773
Position
17; 17 C
AA seq 306 aa
MALCALTSALRSLSLASAAITARVPTLLPAAQIQSNVLLQLPPALVSPSYRPVHMSADRS
AKFVSWKSRTKYTVKPVKMRKSGGRDHTGRIRVHGIGGGHKQNYRMIDFLRFRPEKEKAP
EPFEEKVVVVRYDPCRSADIALVAGGSRKRWIIATENMKAGDTILNSNHIGRMAVAAQEG
DAHPLGALPVGTLINNVESEPGRGAQYIRAAGTCGVLLRKVNGTAIIQLPSKRQMQVLES
CTATVGRVSNVNHNQRVIGKAGRNRWLGKRPNSGLWQRKGGWAGRKIRPLPPMKSYVKLP
SAAAQN
NT seq 921 nt   +upstreamnt  +downstreamnt
atggcgctgtgtgcgctgacgagtgctctgcgctctttgagcctggcatccgcggccatt
accgcccgggttccgactctgctccctgctgcccagatacagagcaatgtcctccttcag
ctgccccctgccttggtgtcgccctcttaccgcccagtgcatatgtctgcggaccgcagt
gccaagtttgtgtcctggaagagtcgtaccaagtacacagttaaaccagtgaagatgagg
aagtctgggggtcgagaccatacaggccgcatccgagtgcatggtatcggtggaggccac
aaacagaattatcgcatgattgactttctacggttccggccagaaaaggaaaaggcacca
gaaccgtttgaggagaaggttgtggtagtccgctatgatccttgtaggtctgcagacata
gctctggttgctgggggtagccggaagcgctggatcattgccacggaaaacatgaaggct
ggagatacaatcctgaactctaatcacataggcaggatggcagtggccgcccaggagggg
gatgcacatccacttggggcgctgcctgtggggaccctcatcaacaacgtagagagcgag
cctggccggggagcccagtatatccgagctgcagggacatgcggtgtgctgcttcggaag
gtgaacgggacagccattatccagctgccctcgaagaggcaaatgcaggtgctggagtca
tgcactgcaactgtaggccgagtatccaacgttaaccataaccagcgggtcatcggcaag
gcaggaaggaaccgctggctgggcaagaggcctaacagtgggctgtggcaacgcaaggga
ggctgggccggccgaaagattcggccactaccacccatgaagagttatgtgaagctgccc
tccgctgctgcccaaaactga

DBGET integrated database retrieval system