KEGG   Mus musculus (mouse): 27400Help
Entry
27400             CDS       T01002                                 

Gene name
Hsd17b6, 17betaHSD9, Hsd17b9, Rdh8
Definition
(RefSeq) hydroxysteroid (17-beta) dehydrogenase 6
  KO
K13369  17beta-estradiol 17-dehydrogenase / all-trans-retinol dehydrogenase (NAD+) / 3alpha(17beta)-hydroxysteroid dehydrogenase (NAD+) [EC:1.1.1.62 1.1.1.105 1.1.1.239]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00140  Steroid hormone biosynthesis
mmu00830  Retinol metabolism
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    27400 (Hsd17b6)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    27400 (Hsd17b6)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.62  17beta-estradiol 17-dehydrogenase
     27400 (Hsd17b6)
    1.1.1.105  all-trans-retinol dehydrogenase (NAD+)
     27400 (Hsd17b6)
    1.1.1.239  3alpha(17beta)-hydroxysteroid dehydrogenase (NAD+)
     27400 (Hsd17b6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 KR
Motif
Other DBs
NCBI-GeneID: 27400
NCBI-ProteinID: NP_038814
MGI: 1351670
Ensembl: ENSMUSG00000025396
UniProt: Q9R092
Position
10; 10 D3
AA seq 317 aa AA seqDB search
MWFYLVTLVGLYHLLRWYRERQVVSHLQDKYVFITGCDSGFGNLLARQLDRRGMRVLAAC
LTEKGAEELRNKTSDRLETVILDVTKTESIVAATQWVKERVGDRGLWGLVNNAGVLQPFA
YIEWYRPEDYMPIFQVNLIGLTQVTISMLFLVKKARGRIVNVSSALGRVALFGGFYSCSK
YGVEAFSDVLRHEVQDFGVKVSIIEPGSFKTEMTDAELTIERTKKVWEAAPEHIKESYGQ
QFFDDFCSTTKRELMKCSRNLSLVTDCMEHALTSTHPRTRYSAGWDAKFFFIPLSYLPAS
LVDYLLAISRGKPAQAA
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgtggttctacctggtaactcttgtgggcctttaccaccttctgcgttggtatcgtgag
aggcaggtggtgagccatctccaagacaagtatgtcttcatcacgggctgtgactctggc
tttgggaacctgctggccagacagctggacaggagaggcatgagggtattggctgcatgt
ctgacggagaagggagccgaggagctgaggaacaagacatctgacaggctggagacagtg
atcctggatgtcaccaagacagagagtattgtggcagccactcagtgggtgaaggagcgt
gttggagacagaggactctggggtttggttaataatgcaggtgtgttacaaccatttgcc
tacattgaatggtacagaccagaggactacatgcctatctttcaagtgaacctcattggt
ttgacccaggtgactataagcatgcttttcctggtaaagaaggctcggggcaggatcgtc
aatgtctccagtgctttgggaagagttgcattgtttggaggattctacagttgctccaag
tatggggttgaggcattttcagatgtgctaaggcatgaggttcaagatttcggggtgaaa
gtcagcataattgaacctgggagcttcaagacggaaatgacagatgcagagttaaccatt
gagagaactaagaaagtctgggaagctgcccctgagcacatcaaggaatcctacggacag
cagttttttgacgacttttgcagcaccaccaaacgagagttgatgaagtgtagcaggaac
ctgagcctagtcacggactgcatggagcacgccctgacctccacgcatcctcgcacccgg
tactcggctggctgggatgccaagtttttcttcatccctctatcttatttgcctgcgtca
ctggtagactacttattggccatatctaggggcaagccagctcaagcagcctga

DBGET integrated database retrieval system