KEGG   Mus musculus (mouse): 27402
Entry
27402             CDS       T01002                                 

Gene name
Pdhx, AI481367, E3bp, Pdx, Pdx1
Definition
(RefSeq) pyruvate dehydrogenase complex, component X
  KO
K13997  dihydrolipoamide dehydrogenase-binding protein of pyruvate dehydrogenase complex
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01100  Metabolic pathways
Module
mmu_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    27402 (Pdhx)
   00020 Citrate cycle (TCA cycle)
    27402 (Pdhx)
   00620 Pyruvate metabolism
    27402 (Pdhx)
  09112 Not included in regular maps
   09113 Global maps only
    27402 (Pdhx)
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Other DBs
NCBI-GeneID: 27402
NCBI-ProteinID: NP_780303
MGI: 1351627
Ensembl: ENSMUSG00000010914
Vega: OTTMUSG00000014841
UniProt: Q8BKZ9
Position
2; 2 E2
AA seq 501 aa
MAASWRLHCNQPLLRYLLGFSSRRSLGLAQGAAAWPVDRGASWRWFHSTQLLQADPIKVL
MPSLSPTMEQGNIVKWLRKEGEAVSAGDSLCEIETDKAVVTLDANDDGILAKIVVEEGAK
NIQLGSLIALMVEEGEDWKQVEIPKDVSAPPPVSKPPAPTQPSPQPQIPCPARKEHKGTA
RFRLSPAARNILEKHSLDASQGTATGPRGIFTKEDALKLVELKQMGKITESRPASAPPPS
LSASVPPQATAGPSYPRPMTPPVSIPGQPNAAGTFTEIPASNIRRVIAKRLTESKSTVPH
AYATADCDLGAVLKVRRDLVKDDIKVSVNDFIIRAAAVTLKQMPGVNVTWDGEGPKQLPS
VDISVAVATDKGLITPIIKDAAAKGIQEIADSVKVLSKKARDGKLMPEEYQGGSFSISNL
GMFGIDEFAAVINPPQACILAVGRFRPVLKLTEDEEGNPQLQQHQLITVTMSSDSRVVDD
ELATRFLETFKANLENPMRLG
NT seq 1506 nt   +upstreamnt  +downstreamnt
atggcggcctcctggaggcttcactgtaaccagccgctgcttcggtaccttctgggattt
agcagccgtcgaagcctgggactggctcagggtgctgctgcttggcctgtcgaccgtgga
gcaagttggaggtggtttcacagtactcagctgctgcaggcggatcctattaaggtccta
atgccatcactgtctcctacgatggagcaagggaacattgtgaaatggctgagaaaggaa
ggtgaagctgtgagtgctggagactcgttatgtgaaattgagacggacaaggctgtggtc
accttagatgcaaacgatgatggcatcttagccaagatagtggttgaggaaggtgctaaa
aatatacagctgggttcactcattgctttgatggttgaagaaggggaagattggaaacag
gtggaaattcccaaggatgtcagtgctccacctccagtctcaaaaccaccagctcctact
cagccctctccacagccgcagattccttgtcccgccaggaaggagcacaaagggacggca
cggttccgcttaagtccagctgcccgcaacattctggaaaaacattcattggacgccagc
cagggcacagccacaggccctcgcgggatcttcactaaagaagatgcactcaagttagtc
gagctgaaacagatgggcaagattactgaatccagaccagcctcagctcctccaccctct
ctctcagcatctgtgcctcctcaggctacagccgggccatcctatcctcggccaatgacc
ccaccagtatccattcctgggcaaccgaatgcagcgggtacattcaccgaaattcctgct
agcaatattcgaagagttatcgctaagaggttaactgaatcaaaaagtactgtgcctcat
gcctatgctactgctgactgtgaccttggcgcagttctaaaggttagacgagatctggtc
aaagatgacattaaagtctcagtaaatgactttatcatcagagcagcagctgttactctt
aaacaaatgcctggggttaatgtcacctgggatggagaaggcccaaagcagctgccctct
gttgacatttcagtggctgtggcaacagataaaggtttaattacaccaatcataaaagat
gcagccgctaagggcattcaggagatcgctgactctgtaaaggttctgtcgaagaaagca
cgggatgggaaattgatgccagaggagtaccaaggaggatcttttagtatttccaacttg
gggatgtttggcatcgatgagttcgctgcagtgattaacccgcctcaggcctgtatcttg
gccgttgggagattccgccccgtgctgaagctgacggaggatgaagaggggaaccctcaa
ctgcagcagcaccagcttataacggtcacaatgtcaagtgacagccgagtggttgatgat
gaactagctaccaggtttcttgaaactttcaaagcaaacctagagaatcccatgcgactt
gggtag

DBGET integrated database retrieval system