KEGG   Mus musculus (mouse): 27403Help
Entry
27403             CDS       T01002                                 

Gene name
Abca7, ABCX, Abc51
Definition
(RefSeq) ATP-binding cassette, sub-family A (ABC1), member 7
  KO
K05645  ATP-binding cassette, subfamily A (ABC1), member 7
Organism
mmu  Mus musculus (mouse)
Pathway
mmu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    27403 (Abca7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    27403 (Abca7)
Transporters [BR:mmu02000]
 ABC transporters, eukaryotic type
  ABCA (ABC1) subfamily
   ABCA1, 2, 3, 4, 7, 12, 13 subgroups
    27403 (Abca7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ABC2_membrane_3 ABC_tran AAA_21 AAA_23 AAA_15 ABC2_membrane_2 DUF4162 AAA_29
Motif
Other DBs
NCBI-GeneID: 27403
NCBI-ProteinID: NP_038878
MGI: 1351646
Ensembl: ENSMUSG00000035722
Vega: OTTMUSG00000032606
UniProt: Q91V24
Position
10 C1; 10 39.72 cM
AA seq 2159 aa AA seqDB search
MALGTQLMLLLWKNYTYRRRQPIQLLVELLWPLFLFFILVAVRHSHPPLEHHECHFPNKP
LPSAGTVPWLQGLVCNVNNSCFQHPTPGEKPGVLSNFKDSLISRLLADTRTVLGGHSIQD
MLDALGKLIPVLRAVGGGARPQESDQPTSQGSVTKLLEKILQRASLDPVLGQAQDSMRKF
SDAIRDLAQELLTLPSLMELRALLRRPRGSAGSLELVSEALCSTKGPSSPGGLSLNWYEA
NQLNEFMGPEVAPALPDNSLSPACSEFVGTLDDHPVSRLLWRRLKPLILGKILFAPDTNF
TRKLMAQVNQTFEELALLRDLHELWGVLGPQIFNFMNDSTNVAMLQRLLDVGGTGQRQQT
PRAQKKLEAIKDFLDPSRGGYSWREAHADMGRLAGILGQMMECVSLDKLEAVPSEEALVS
RALELLGERRLWAGIVFLSPEHPLDPSELSSPALSPGHLRFKIRMDIDDVTRTNKIRDKF
WDPGPSADPFMDLRYVWGGFVYLQDLLEQAAVRVLGGGNSRTGLYLQQMPHPCYVDDVFL
RVLSRSLPLFLTLAWIYSVALTVKAVVREKETRLRETMRAMGLSRAVLWLGWFLSCLGPF
LVSAALLVLVLKLGNILPYSHPVVIFLFLAAFAVATVAQSFLLSAFFSRANLAAACGGLA
YFALYLPYVLCVAWRERLHLGGLLAASLLSPVAFGFGCESLALLEEQGDGAQWHNLGTGP
AEDVFSLAQVSAFLLLDAVIYGLALWYLEAVCPGQYGIPEPWNFPFRRSYWCGPGPPKSS
VLAPAPQDPKVLVEEPPLGLVPGVSIRGLKKHFRGCPQPALQGLNLDFYEGHITAFLGHN
GAGKTTTLSILSGLFPPSSGSASILGHDVQTNMAAIRPHLGICPQYNVLFDMLTVEEHVW
FYGRLKGVSAAAMGPERERLIRDVGLTLKRDTQTRHLSGGMQRKLSVAIAFVGGSRVVIM
DEPTAGVDPASRRGIWELLLKYREGRTLILSTHHLDEAELLGDRVAMVAGGSLCCCGSPL
FLRRHLGCGYYLTLVKSSQSLVTHDAKGDSEDPRREKKSDGNGRTSDTAFTRGTSDKSNQ
APAPGAVPITPSTARILELVQQHVPGAQLVEDLPHELLLVLPYAGALDGSFAMVFQELDQ
QLELLGLTGYGISDTNLEEIFLKVVEDAHREGGDSRPQLHLRTCTPQPPTGPEASVLENG
ELAPQGLAPNAAQVQGWTLTCQQLRALLHKRFLLARRSRRGLFAQVVLPALFVGLALFFS
LIVPPFGQYPPLQLSPAMYGPQVSFFSEDAPGDPNRMKLLEALLGEAGLQEPSMQDKDAR
GSECTHSLACYFTVPEVPPDVASILASGNWTPESPSPACQCSQPGARRLLPDCPAGAGGP
PPPQAVAGLGEVVQNLTGRNVSDFLVKTYPSLVRRGLKTKKWVDEVRYGGFSLGGRDPDL
PTGHEVVRTLAEIRALLSPQPGNALDRILNNLTQWALGLDARNSLKIWFNNKGWHAMVAF
VNRANNGLLHALLPSGPVRHAHSITTLNHPLNLTKEQLSEATLIASSVDVLVSICVVFAM
SFVPASFTLVLIEERITRAKHLQLVSGLPQTLYWLGNFLWDMCNYLVAVCIVVFIFLAFQ
QRAYVAPENLPALLLLLLLYGWSITPLMYPASFFFSVPSTAYVVLTCINLFIGINSSMAT
FVLELLSDQNLQEVSRILKQVFLIFPHFCLGRGLIDMVRNQAMADAFERLGDKQFQSPLR
WDIIGKNLLAMMAQGPLFLLITLLLQHRNRLLPQSKPRLLPPLGEEDEDVAQERERVTKG
ATQGDVLVLRDLTKVYRGQRNPAVDRLCLGIPPGECFGLLGVNGAGKTSTFRMVTGDTLP
SSGEAVLAGHNVAQERSAAHRSMGYCPQSDAIFDLLTGREHLELFARLRGVPEAQVAQTA
LSGLVRLGLPSYADRPAGTYSGGNKRKLATALALVGDPAVVFLDEPTTGMDPSARRFLWN
SLLSVVREGRSVVLTSHSMEECEALCTRLAIMVNGRFRCLGSSQHLKGRFGAGHTLTLRV
PPDQPEPAIAFIRITFPGAELREVHGSRLRFQLPPGGRCTLTRVFRELAAQGRAHGVEDF
SVSQTTLEEVFLYFSKDQGEEEESSRQEAEEEEVSKPGRQHPKRVSRFLEDPSSVETMI
NT seq 6480 nt NT seq  +upstreamnt  +downstreamnt
atggccttaggcacacagctgatgcttctgctgtggaaaaattacacctatcgacggaga
caaccgatccaactactagtggagttgctttggcccctcttcctcttcttcatcctagtg
gctgtccgtcactcccacccccctctggagcatcacgaatgccactttccaaacaagcca
ttaccatcggcgggcacggtgccctggctgcagggccttgtctgcaacgtaaacaactcc
tgcttccagcacccaacgcctggcgagaagcctggggtcctgagtaactttaaggattcc
ttgatctcgaggctcctcgctgatacccgcacagtgctcgggggccacagcatccaggac
atgctggatgccctggggaaactgatccccgtgctcagggcagttggaggtggagcacga
ccacaggagagtgaccagccgaccagtcaagggtcagtgactaagcttctggagaagatc
ctgcaaagggcatccctggatcctgtgctgggtcaagcccaggattctatgagaaagttc
tcagatgctatcagggatcttgcccaggagctcctgacactgcccagcctgatggagctc
cgagctttgctgcggaggccccgagggtcagctggttctctggagctggtttcggaggcc
ctctgcagtaccaagggacccagcagtccagggggcctgtccctcaattggtacgaagcc
aaccagcttaatgagttcatggggccagaggtggcccctgccctgcctgacaacagtctc
agccctgcctgctctgagtttgtggggacactggatgaccaccctgtgtctcggctgctc
tggaggcgcctgaagccattgatcctcgggaaaattctctttgcacctgacacaaacttc
actcggaagctcatggctcaggtgaaccagaccttcgaggagctggctctgttgagggac
ctacacgaactctggggggtgctgggaccccagatcttcaacttcatgaatgacagtacc
aacgtggccatgcttcagaggcttctggatgtggggggcacagggcagaggcagcagaca
cccagagcccagaagaagttggaggctatcaaagactttctggatcctagtaggggtggc
tacagctggcgggaggcccacgcagatatgggacgcctggctggaatcctaggacaaatg
atggagtgtgtgtccctggacaagctggaggctgtgccctcagaggaagctcttgtgtcc
cgtgccctggagctgctgggtgagcgccgcctctgggcaggcatcgtgttcctgagccca
gagcatcctctggacccatccgaactgtcatctccagccctgagtcctggccacctacga
ttcaagattcgaatggatatcgatgatgtcacaaggaccaataagatcagggacaagttt
tgggacccaggtccgtcagcagatcctttcatggaccttcggtatgtgtggggaggcttc
gtgtacctgcaggacctgctggagcaggcagctgtgcgagtgctcggtggcgggaactcc
cgcacaggtctctacctgcagcagatgccacacccctgctacgtggatgatgtgttcctg
cgggtgctgagccggtctctgcctctgtttctgactctggcctggatttattcggtggcg
ctcactgtgaaggccgtggtgcgtgagaaagagacacggctgcgagaaaccatgcgtgcg
atggggctgagccgcgcggtgctctggcttggttggttcctcagctgcctgggacccttc
ctggtcagcgctgcgttgctggtattagtgcttaagctagggaacatccttccttacagc
cacccggttgtaatcttccttttcttggcggccttcgcggtggccaccgtcgctcagagt
tttctgctcagcgccttcttctccagggccaacctggcagcagcctgcggggggctcgcc
tattttgcgctctatctgccctacgtactgtgtgtggcctggcgcgagcgcctgcacctg
ggcggactcttagctgcgagcctgctgtcccctgtagcctttggctttggatgcgaaagc
ctggcgctactagaggagcagggagacggggctcagtggcacaatttgggcacaggcccc
gcggaggacgtcttcagcctggcccaggtgtctgccttcctgttgcttgatgccgtcatc
tacggccttgccctctggtacctagaggctgtgtgcccaggccagtatggaatccctgaa
ccatggaatttcccttttcggaggagctactggtgtggacctgggcctcccaagagttct
gtcttggcccctgccccacaagatcccaaggttctggtggaagagccaccccttggcctg
gttcctggtgtctccattcgaggcctgaagaaacattttcgtggctgtccgcagccagcc
ctgcaaggactcaaccttgacttctacgaaggccacatcactgcctttttgggtcacaac
ggggctggcaagacaaccacactgtccattttgagtggtctcttcccacccagtagtggc
tcggcctccatcctgggccatgatgtacaaaccaacatggcagccatccggccccacctg
ggcatctgcccgcagtacaatgtgctgtttgatatgctgacagtggaagaacatgtttgg
ttctatggccgtttgaaaggcgtgagtgcagccgccatgggccccgagcgggaacgtctg
atacgggatgtggggcttaccctcaagcgggacacacagacacgccacctctctggtgga
atgcagagaaaactttctgtggccattgcctttgtgggtggctctcgtgtggtcatcatg
gacgagcccactgctggtgtggaccccgcttcccgccgtggcatttgggaattgctactt
aagtacagagaaggtcggacactgattctctccactcaccacctggatgaggcagagctc
ttgggagatcgcgtggccatggtggcaggtggctctttgtgctgctgtgggtccccgctt
ttcttgcgccgacacttgggctgcggttactacctgaccctggtgaagagttctcagtcc
ctcgtcacccatgatgctaagggagacagtgaggaccccagacgggaaaagaagtcagat
ggcaatggcaggacgtcagacacagcgttcacacgaggaacctcagacaagagcaaccag
gccccggctcctggcgccgttcccatcaccccaagcacagcccggatactagagctagtg
cagcagcatgtgcctggagcacaactcgtggaggacctgccccatgagcttctgcttgtg
ctaccctatgcgggggccctggatggcagcttcgccatggtcttccaggagctggatcag
cagctggagctcctgggtctcacaggctacgggatctcggacaccaacctggaggagatc
ttcctaaaggtggtggaggatgcgcacagagaaggtggggactctagaccgcagctgcac
cttcgcacatgcactccacagccccccacagggccagaggcatcagttctggagaatggg
gagctggccccacagggcttggcacccaacgctgcccaagtgcaaggctggacacttacc
tgtcaacagctccgggctctgctccacaagcgttttctgcttgctcgccgcagccgccgg
ggcctgtttgcacaggttgtgttgcctgccctctttgtgggcctggccctgttcttcagc
ctcattgtgcctccttttggccagtacccacccctgcagctcagccctgctatgtatggc
cctcaggtctcgttcttcagtgaggatgcccctggggaccccaaccggatgaagctgctg
gaggctctgctaggggaggctgggctgcaggaacccagtatgcaggacaaagatgccagg
ggatctgagtgtacacactccctagcttgctacttcacggtccctgaggtccctcctgat
gtggccagcatcctggccagtggcaactggacgccagaatctccatccccagcttgccaa
tgcagtcagcctggagcccgccgcctgttgccagattgcccggctggagctgggggtcca
ccacccccccaggctgtggctggcttgggggaggtggtccagaacctcactggccgaaat
gtgtctgactttttggtgaagacataccccagcctggtgcgccgaggcctaaagaccaag
aagtgggtggatgaggtcagatatgggggcttctccctgggaggccgagatccagacctg
cccacagggcatgaggtggtccgcacattggcagagattcgggcactgctgagcccccaa
cctgggaatgcgctagaccgtatcctgaacaacctcactcagtgggcccttggccttgat
gctcggaacagcctcaagatctggttcaacaacaagggctggcatgccatggtggccttt
gtgaaccgagccaacaatggactcctacatgccctcctaccatctggtccagtccgccat
gcccacagcatcactacactcaaccatcctttgaacttgaccaaggagcagctatctgaa
gctacactgatagcctcctctgtggatgtccttgtctccatctgtgtggtcttcgccatg
tcatttgtcccagccagctttaccctggtcctcatagaggaacgcatcaccagagccaag
catctgcagctggtcagcggcctgccccaaaccctctattggcttggcaacttcctctgg
gacatgtgtaactacttggtggcagtgtgcatagtggtgttcatcttcctagcctttcag
cagagagcctatgtggccccagagaacctgcctgctctcttactcttgcttctgctgtat
gggtggtctatcacaccactcatgtacccagcctccttcttcttctcagtgcccagcacg
gcctatgtggtgctcacctgcatcaacctcttcattggcatcaatagcagcatggccacc
ttcgtgctagaactgctttcagatcagaacctgcaagaagtgagccggatcctgaaacaa
gtgtttcttattttcccccacttttgccttggccgagggctcattgacatggttcggaac
caggccatggcagatgcctttgagcgcttaggagacaagcaatttcagtcacccctacgc
tgggacatcattggcaagaacctcctggccatgatggcccagggacctctgttcctcctc
atcacactcctgctccaacaccgcaaccgtctcctgccacaatcaaaaccaagactgctg
ccgcccctgggggaggaggatgaggatgtggctcaagagcgtgagcgggtgaccaagggg
gctacccagggggatgtgctagtcctcagggacttgaccaaggtttaccgtgggcagagg
aacccagctgtggatcgcctgtgcttagggatcccccctggggagtgtttcgggctgctg
ggtgtcaacggggcagggaagacatccaccttccgcatggtgacaggggacacactgccc
agcagtggtgaagcagtactggcaggccacaacgtggcccaggagcggtctgccgcacac
cgcagcatgggctactgtccccagtctgatgccatcttcgacctgctgaccggccgggaa
catctggaactgtttgctcgcctgcgcggggtgcccgaggcccaagttgcccagactgcg
ctctctggcctggtgcgcctgggccttcctagctatgcagaccgacccgcgggtacctac
agcggaggcaacaaacggaagctggcgacagccttagctctggttggtgacccagctgtg
gtctttctggacgagcccaccacaggcatggacccaagtgcgcggcgatttctttggaac
agcttgctgtccgtggtgcgcgagggccgctccgtagtgctcacgtcgcacagcatggag
gagtgcgaagcgctctgcacgcgcctggccatcatggtgaacgggcggttccgctgtctg
ggaagctctcagcatctcaaaggcaggttcggggctggccacacactgactctaagggtc
ccaccggaccagcctgagccggcgatagccttcatcaggatcacattccctggggctgaa
ctccgggaggtgcacggcagccgtctgcgcttccaactgccaccggggggcagatgcacc
ctgacacgagtgttcagggagctggctgcccagggcagggcccacggtgtggaggacttc
tctgtgagccagaccactctggaggaggtgttcctatatttctccaaagaccaaggggaa
gaggaagagagcagtcggcaggaggctgaagaagaggaggtttccaaacctggccggcag
catcccaaacgtgtcagccgattcctggaagaccccagctctgtggagaccatgatctga

DBGET integrated database retrieval system