KEGG   Mus musculus (mouse): 27404Help
Entry
27404             CDS       T01002                                 

Gene name
Abca8b, Abca8
Definition
(RefSeq) ATP-binding cassette, sub-family A (ABC1), member 8b
  KO
K05650  ATP-binding cassette, subfamily A (ABC1), member 8
Organism
mmu  Mus musculus (mouse)
Pathway
mmu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    27404 (Abca8b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ABC_tran ABC2_membrane_3 AAA_21 RsgA_GTPase SMC_N AAA_29 AAA_15 AAA_23 AAA_16 MMR_HSR1 Arm-DNA-bind_2 Dynamin_N
Motif
Other DBs
NCBI-GeneID: 27404
NCBI-ProteinID: NP_038879
MGI: 1351668
Ensembl: ENSMUSG00000020620
Vega: OTTMUSG00000003354
UniProt: Q8K440 A2AM56
Position
11 E1; 11 72.88 cM
AA seq 1620 aa AA seqDB search
MIKREISVRQQTCALLQKNLLKKWRLKRESLMEWVSSLLLLLFLYWYPHGHGATDLSSVP
TKDLGRVDSFRQSGFMIGYTPVTSMTQQIMEKVAATPFMADKKVLGLLDEENIKELTESH
AEIIRVIFSDTFSYHLKFQFDQRIPTSRELRDHNAHCDGLYEDVNCLIAIFWKEGFVALQ
AAINAAIIETTTNHSVMEELLSVSGKFMKIHPFVRQEGILTDFFIFTCIISFSPITYYVS
INVARERKRMKGLMMMMGLRDPAFWLSWGLLYAGFVFIMALSLALVIKSVQFFILTSFMV
VFSLFLLYGLSMITLAFLMSALVRKSVLTGLSVFLLTIFWGSLGFTSLYRYLPAPVEWTL
SLFSPFAFTLGMAQLLRVDYDLNSNAPPDPASGSNLIIATNFMLVFDAFLYLALMMYFEK
VLPNEYGHQHSPLFFLKSSFWLQTRKPAHVILEDGIDPVPSSGDSFEPVSPEFHGKESIR
IRNISKEYKGKPNKIEALKDLTLDIYEGQITAVLGHSGAGKSTLLNILSGLSVPTKGSVT
IYNNNLSEMADLENILRIAGVCPQANVQFDFLTVRENLRLFAKIRGIPPQDVEKEVQRVL
LELEMKNIQNILAQNLSGGQKRKLTFGIAILGDSQIFLLDEPTAGLDPFSRHRVWNLLKE
RRADRVVLFSTQFMDEADILADRKVFISNGRLKCAGSSLFLKKKWGVGYHLSLQLKEVCV
PENITSLVKQHIPAAKLSAEGEGKLLYTLPLETTYRFPELCQSLDSCPGLGIENYGVSMT
TLNEVFLKLEGKASIDEPEVDIVGEGQTERSGDTERLMEMEQTLSSLRETEKTDGMALWR
QQTCAIAKVRLLKLKHERKTLLSVLLILVVGICPFLFENISTKIRQSSYTWELSPHDYFL
APGQQPQGMLTQLLIINKTEASIDDFIHSVERQNIALEVDASGTRDGTDDPSYNGALIVS
GNEKNHSFSFACNTKRLNCFPVLMDILSNGLLGMVKPSARIQTDRSTYLMDETIHPLEDL
WKTAFWLILTSACPPYIAMSSVTDYKNRAWFQLRVSGLFPSAYWVGQAMVDIPLYCFVFL
FMSLMDYLFRFPDTMFSIISHVIQIPCSVGYAISLIFLTYVISFISRKGKKNSGIWSLSF
YIITVFSVAVILLAFDVDGTQYYIIFLIPPSTLVGCLILSLHLFIGQIFEEGQVIEPFLV
FLIPFLHVFIFIFTLRCLEWKFGKKTMRKDPIFRISPRNNDVYQNPEEPEDEDEDVQMER
MRTANALVSTSFDEKPVIIASCLRKEYAGKQKHCLSKKKAKIATRNVSFCVRKGEILGLL
GHNGAGKSTSLKMISGDTKVTAGQVLLKGSREGDTPGFLGYCPQENALWPNLTVKEHLEI
FAAVRGLRKSHAAVAITRLADALKLQDQLKSPVKTLSEGVKRKLCFVLSILGNPSILLLD
EPSTGLDPEGQQQIWQAIRAIIKNTDRGALLTTHYMAEAEALCDRVAILVSGRLRCIGSI
QHLKSKFGKDYLLEMKVKTLEQVEPLNTEILRLFPQASRQERYSSLMAYKLPVEAVQPLS
QAFFKLEKVKQTFDLEEYSLSQSTLEQVFLELSKEQELDGLELEELDSSIKWKLLPQEEA
NT seq 4863 nt NT seq  +upstreamnt  +downstreamnt
atgatcaagagagagataagtgtgcgccaacaaacttgtgctttattacagaagaacctt
cttaagaaatggagactgaaaagggagtccttgatggagtgggtgagctccttgctcctt
ctgcttttcttgtattggtatccccatggtcatggagctactgacctgtcttcagtgccc
accaaggatctgggacgagtcgattctttcagacaatctgggttcatgatagggtacacg
cctgtcaccagcatgacacaacagataatggagaaggtagctgcaacccctttcatggca
gataaaaaagtcttgggactgttggatgaagaaaatatcaaggaattaacagaaagtcat
gcagaaataataagagtcattttttctgacacattctcataccatctgaaattccagttt
gatcagagaatcccaacgtcgagggaactcagagaccataatgctcattgtgatggactg
tatgaagatgtcaactgtctgatagccatattctggaaggaaggatttgtggctcttcaa
gctgccatcaatgctgccatcatagaaaccacaacaaaccattcagtgatggaggaactg
ctatcagtgtcagggaaattcatgaagatccatccttttgtccgtcaagaaggaattctg
actgatttctttattttcacctgcatcatttccttctccccaatcacctattatgtgtca
atcaatgttgcaagagagaggaaaaggatgaagggcttgatgatgatgatgggccttcga
gatccagcattctggctatcttggggtctgctctatgctggctttgtcttcattatggct
ctatccctggcacttgttatcaaatctgtccagttttttattctaaccagcttcatggtg
gtctttagcctcttcctcctttatggattatctatgatcactttggctttcctaatgagt
gccttggtgaggaagtctgtcctcactggcctgtctgtgtttcttctcaccatcttctgg
ggaagtctaggcttcacatccctgtacagatacctccctgcacctgtggaatggactctc
agtctctttagcccctttgccttcacactaggaatggcccagctcttacgtgtggattat
gatttaaattctaatgcaccccctgatccagccagtggctcaaatctgattatagcaacc
aatttcatgctggtatttgatgcgtttttgtatctggccctgatgatgtacttcgaaaaa
gttctgccaaatgaatacggacatcagcactctcccctgtttttcctgaaatcttcattt
tggctacaaacacgaaagcctgctcatgtgattcttgaagatggaatagaccccgttcct
tcatcaggtgactcgtttgaaccggtgtccccagaattccacgggaaagaatccatcaga
atcagaaatatttcaaaagaatacaaaggaaagcccaataaaatagaagccttaaaagac
ctgacgttggacatatatgaaggccaaatcacagcagtacttggtcacagtggagctggg
aaatcaacactgttaaatattcttagcggattatctgttcctactaaaggttctgtcacc
atctataataataacttatcagaaatggctgaccttgaaaacatcttgaggattgctgga
gtttgtccacaagccaatgttcaatttgacttccttactgtgagagaaaacctcaggctt
tttgctaaaataagaggaattccaccccaagatgtggagaaagaggtgcaaagggttttg
ctagaattggaaatgaaaaatatccaaaatatccttgctcaaaacctaagtgggggacag
aagagaaagctgacttttggaatcgccattttaggagattctcagattttcctactggat
gagcccaccgctggcctggatcccttttcaaggcaccgggtgtggaatctcctgaaggag
cgcagagcagaccgtgtggtcctcttcagcacgcagttcatggatgaggctgacatcctg
gctgataggaaagtgttcatctccaatgggaggctgaagtgtgcaggatcatcgctcttt
ctgaagaagaaatggggagttgggtatcacttaagtttgcagctgaaagaagtctgtgtt
ccagaaaacatcacatcgcttgttaaacagcacatccctgcagccaagctatcagctgaa
ggggaaggaaagcttctctatacattacccttagaaacaacttatagatttccagagctt
tgccagagtcttgacagctgtcctggactgggaattgaaaactatggtgtttccatgaca
actttgaatgaggtgttcctgaagctagaaggaaaagcatcaattgatgaaccagaggtt
gacatcgtgggagaaggacaaacagagagatctggggacacagaaaggcttatggagatg
gagcaaactctctcttcacttagggaaacagagaagacagacggcatggcactctggagg
cagcaaacctgtgcgatcgcaaaggttcgcctgttgaagttaaagcacgaaaggaaaaca
cttttatctgtgctcttgatactggtagtcggcatctgtccttttctttttgaaaatatc
tcaacgaaaatacgtcaaagctcttacacttgggaactttccccacacgattacttcctt
gctccgggacaacagccccagggcatgctcactcagttattgatcattaataagacagag
gcaagcattgacgactttatccattctgtggaacgccagaacatagctttggaagtcgat
gcttctggaaccagagatggtacagatgacccatcctacaatggagcccttatagtgtct
ggcaatgagaagaaccacagcttttcgtttgcatgcaacaccaagagactgaactgcttc
ccagttctgatggacatcctgagcaacgggctacttggaatggttaaaccgtcagcccgc
atccaaaccgacagaagcacatatctcatggatgaaactattcatcctttagaagaccta
tggaagactgcattctggctgattctgacctccgcttgccctccttatattgccatgagc
agtgtcacagattataagaacagagcttggttccagctgcgggtctccggcctcttccct
tcggcttactgggtcgggcaggcaatggtggacattcccctgtactgctttgtcttcctc
ttcatgtcgttaatggactacctttttcgcttcccagataccatgttttctattataagc
cacgtcatacaaatcccgtgttctgttggctatgccatatccctgatcttcttaacatac
gtgatttcgttcatttctcgcaaggggaaaaaaaacagcggcatttggtcacttagcttc
tatatcatcactgtgttctcagtggctgtaatattgctggcttttgatgtggatggtaca
cagtactacatcatctttttgataccaccgtccactctggttggatgcttgatcttgtct
ttgcatcttttcataggtcaaatctttgaagaaggacaagttatagagccattcctggta
ttcctcattcctttccttcatgttttcatttttatttttacccttcgatgtctggaatgg
aagtttggaaagaaaacaatgaggaaagatcccatctttagaatttctccaagaaacaat
gatgtgtatcaaaacccagaagagccagaagatgaggatgaagatgttcaaatggagaga
atgagaacagcgaatgccttggtatccaccagttttgatgagaagccagtcatcattgcc
agctgcctacgcaaagaatatgcagggaagcagaagcattgcctttccaagaagaaggcc
aagatagccactaggaatgtctcgttttgtgtcaggaaaggtgagattctaggattgttg
ggacacaatggagctggcaaaagtacatctcttaaaatgataagtggagacacaaaagtc
acagctgggcaggtgttactgaaagggagcagagaaggggacaccccggggttcctgggg
tactgtcctcaggagaatgctctgtggcccaacctcactgtgaaggagcacctggagata
tttgctgcagtgaggggcttgcgcaaaagtcacgctgcagtcgccatcacaaggttggca
gatgcgctcaagctgcaggaccagctgaagtctcctgtgaagacgctgtcagagggagtg
aagagaaagctgtgcttcgtgctgagcatcctggggaacccatctatattgcttctagat
gagccgtccactgggctggatcctgaggggcagcagcaaatatggcaagcaatcagggcc
atcataaaaaatacagacaggggtgccctgctgaccacccattacatggcagaggctgag
gctctgtgtgaccgagtggccatcctggtgtctggaaggctgaggtgtattggatccatc
caacatctcaaaagcaaatttggcaaagattacctgctggagatgaaggtgaagaccctc
gagcaggtggagcccctcaatacggagatcctcaggctttttccccaggcttctaggcag
gaacggtactcttctctgatggcttacaaattaccagtggaagctgtacagcctttatcc
caagctttcttcaagttagagaaagttaagcagacctttgacctggaggagtacagcctc
tctcagtctaccctggagcaggtcttcctagagctctccaaggagcaggagctggatggc
cttgaattagaagaattagactcctccataaagtggaagctcctcccacaggaagaggct
taa

DBGET integrated database retrieval system