KEGG   Mus musculus (mouse): 27406
Entry
27406             CDS       T01002                                 

Symbol
Abcf3, AI326318, AU016058, BB119416
Name
(RefSeq) ATP-binding cassette, sub-family F (GCN20), member 3
  KO
K06158  ATP-binding cassette, subfamily F, member 3
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:mmu03012]
    27406 (Abcf3)
Translation factors [BR:mmu03012]
 Eukaryotic type
  Initiation factors
   Initiation associated factors
    27406 (Abcf3)
SSDB
Motif
Pfam: ABC_tran ABC_tran_Xtn AAA_21 SMC_N AAA_22 AAA_16 MMR_HSR1 AAA_29 NACHT RsgA_GTPase AAA RNA_helicase AAA_15 DUF1672 AAA_23 Dynamin_N DUF87
Other DBs
NCBI-GeneID: 27406
NCBI-ProteinID: NP_038880
MGI: 1351656
Ensembl: ENSMUSG00000003234
Vega: OTTMUSG00000023912
UniProt: Q8K268
Position
16:20367309..20380353
AA seq 709 aa
MATCADILRSEFPEIDGQVFDYVTGVLHSGSADFESVDDLVEAVGELLQEVSGDSKDDAG
IRAVCQRMYNTLRLAEPQNQGNSQVLLDAPIQLSKIMENYDCDTKLPGLLKREQSSTVNA
KKLEKAEARLKAKQEKRSEKETLKTSNPLVLEEASASQAGSRKESRLESSGKNKSYDVRI
ENFDVSFGDRVLLAGADVNLAWGRRYGLVGRNGLGKTTLLKMLATRSLRVPAHISLLHVE
QEVAGDDTPALQSVLESDTVREDLLRQERELSLRIAAGRAEGSEAAQLAEIYGKLEEIEA
DKAPARASVILAGLGFTPKMQQQPTREFSGGWRMRLALARALFARPDLLLLDEPTNMLDV
RAILWLENYLQTWPSTILVVSHDRNFLNAIATDIIHLHSQRLDGYRGDFETFIKSKQERL
LNQQREYEAQQQYRQHIQVFIDRFRYNANRASQVQSKLKMLEKLPELKPVDKESEVVLKF
PDGFEKFSPPILQLDEVDFYYDPKHSIFSRLSVSADLESRICVVGENGAGKSTMLKLLMG
DLSPVRGIRHAHRNLKIGYFSQHHVEQLDLNVSAVELLARKFPGLPEEEYRHQLGRYGIS
GELAMRPVASLSGGQKSRVAFAQMTMPCPNFYILDEPTNHLDMETIEALGQALNNFRGGV
ILVSHDERFIRLVCKELWVCENGSVTRVEGGFDQYRALLQEQFRREGFL
NT seq 2130 nt   +upstreamnt  +downstreamnt
atggcgacttgcgctgatatcctgcgaagcgagttccctgaaattgacgggcaggtcttc
gactacgtgaccggtgtcttgcacagtggcagcgcggatttcgagtctgtggatgacctg
gtggaagctgtcggggaactattgcaagaagtgtccggggacagcaaggatgacgctggc
attagggctgtctgtcagcgcatgtacaacactctacgcctggctgaaccgcagaaccag
ggaaacagccaggtgctactggacgcccccatccagttgtcgaagataatggaaaactat
gactgtgacaccaaacttccaggactgctaaagagggaacagtcctcgacagtaaatgcg
aagaaactagagaaggctgaagctcgactgaaggcaaagcaggagaagcgttcagagaag
gaaacactgaagaccagcaaccctctagtcttggaggaggcgtcagctagccaggcaggc
agcagaaaagagagtcgattggaatcatctggcaagaacaagtcctatgatgtgcgaatt
gagaactttgatgtctcttttggtgacagggtactgctggctggagcagatgtaaacttg
gcatggggccgacgctacggcctggtgggacgcaatggtctggggaagacgacattgcta
aagatgctggctacccggagcttgcgtgtcccagcccatatttccctactgcatgtagag
caggaagttgctggagatgacactcctgccttgcagagtgtgctggaaagtgacaccgta
cgagaggacctgctacggcaggaacgggagctcagcctcaggattgccgctggcagggca
gaaggttcagaagctgcacagctggcagaaatctatgggaagctggaggagattgaggca
gataaggcacctgccagagcatcagtcattcttgcgggccttggttttactcctaaaatg
cagcagcagcctaccagggagttctcaggtggctggaggatgagattggccttagcccga
gctctctttgccaggccagaccttctgctgttagacgaacccacaaacatgctggatgta
agggccatcctgtggttggagaattacctgcagacgtggccctccactatcctagttgtc
tctcatgaccgaaacttcctgaatgccattgccacagacatcatccacttgcatagccaa
cggctagacggttaccggggggactttgaaaccttcatcaagagcaagcaggagcgcctt
ctcaaccagcagcgcgagtatgaggcccagcagcagtatcgccaacacatccaggttttc
atcgaccgttttcgatacaatgcaaacagagcctctcaagtgcagagtaaactgaagatg
ttggagaagctacctgaactaaaaccggtggacaaggaatccgaggtggtgttgaagttc
cccgatggatttgagaagttctcaccgcccattctgcagctagatgaggtggatttctac
tatgatcctaagcacagcatcttcagtcgcctgtctgtctctgctgatcttgagtcccgc
atctgtgtggttggggagaatggggctgggaaatctactatgctgaagctgctcatgggg
gacctgtctcctgttcggggtatcaggcatgcccacaggaatctgaagataggctatttt
agccagcaccacgtggaacagctagacttgaatgtcagtgctgtggaactcctggctcga
aaatttcctgggctacctgaagaggaatatcgtcaccaattgggccggtatggcatctct
ggagaactggccatgcgtcctgttgcgagcttatctgggggccagaaaagccgggtagcc
tttgctcagatgaccatgccttgccccaacttctatattctggatgaacccacaaaccac
ctggacatggagaccattgaagctttgggccaggctctcaacaacttcaggggtggtgta
attctggtatctcatgatgagcgcttcatccgactggtgtgcaaggagctgtgggtgtgt
gagaacggcagtgtcactcgggttgaggggggctttgaccagtaccgggccctcctccaa
gaacagttccgccgggagggcttcctctag

DBGET integrated database retrieval system