KEGG   Mus musculus (mouse): 27407Help
Entry
27407             CDS       T01002                                 

Gene name
Abcf2, 0710005O05Rik, Drr3, E430001O06
Definition
(RefSeq) ATP-binding cassette, sub-family F (GCN20), member 2
  KO
K06185  ATP-binding cassette, subfamily F, member 2
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:mmu03009]
    27407 (Abcf2)
Ribosome biogenesis [BR:mmu03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    27407 (Abcf2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ABC_tran ABC_tran_Xtn AAA_21 SMC_N AAA_29 RsgA_GTPase MMR_HSR1 AAA_15 AAA_33 AAA_24 AAA_16 AAA_22 AAA_14 AAA_28 AAA_18 AAA_23 RNA_helicase Dynamin_N AAA_30 Rop
Motif
Other DBs
NCBI-GeneID: 27407
NCBI-ProteinID: NP_038881
MGI: 1351657
Ensembl: ENSMUSG00000028953
Vega: OTTMUSG00000053669
UniProt: Q99LE6
Position
5; 5 A3
AA seq 628 aa AA seqDB search
MPSDLAKKKAAKKKEAAKARQRPRKGHEENGDAVTEPQVAEEKIEEANGRETTGDGEVDL
LTKELEDFEMKKAAARAVTGVLASHPNSTDVHIINLSLTFHGQELLSDTKLELNSGRRYG
LIGLNGIGKSMLLSAIGKREVPIPEHIDIYHLTREMPPSEKTPLQCVMEVDTERAMLERE
AERLAHEDAECEKLMELYERLEELDADKAEMRASRILHGLGFTPAMQRKKLKDFSGGWRM
RVALARALFIRPFMLLLDEPTNHLDLDACVWLEEELKTFKRILVLVSHSQDFLNGVCTNI
IHMHNKKLKYYTGNYDQYVKTRLELEENQMKRFHWEQDQIAHMKNYIARFGHGSAKLARQ
AQSKEKTLQKMMASGLTERVVSDKTLSFYFPPCGKIPPPVIMVQNVSFKYTKDGPCIYNN
LEFGIDLDTRVALVGPNGAGKSTLLKLLTGELLPTDGMIRKHSHVKIGRYHQHLQEQLDL
DLSPLEYMMKCYPEIKEKEEMRKIIGRYGLTGKQQVSPIRNLSDGQKCRVCLAWLAWQNP
HMLFLDEPTNHLDIETIDALADAINEFEGGMMLVSHDFRLIQQVAQEIWVCEKQTITKWP
GDILAYKEHLKSKLVDEEPQLTKRTHNV
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atgccttccgacctggccaagaagaaggcagccaaaaagaaggaggctgccaaagcccga
cagcgacccagaaagggacatgaagaaaatggagatgctgtcacagaacctcaggtggca
gaagagaaaatcgaggaggccaatggcagagagaccacaggagatggagaagtagatttg
ctgaccaaggagctggaggactttgagatgaagaaagctgctgctcgagctgtcaccggt
gtcctggcttctcaccccaacagtactgatgtccacattatcaacctctcccttaccttt
catggtcaagagctgctcagcgacaccaaactggaattaaactcaggccggcgctatggc
ctcattggcttaaatggaattggaaagtccatgctgctctcggctattgggaaacgtgaa
gtgcccatcccagagcacatcgacatctaccatctgactcgtgagatgcctcctagcgaa
aaaacacccttgcagtgtgtgatggaggtggacacagagcgggccatgctggagagagag
gctgagcggttagcacatgaggatgcggagtgtgaaaagctcatggagctctatgaacgg
ctggaagagctggatgctgacaaagctgagatgagggcctcaaggatcttacatggattg
ggcttcacacctgctatgcagcgcaagaagctgaaagacttcagtggtggctggcggatg
agagttgctcttgctagagccctctttattcggcccttcatgctgcttctggacgagcct
accaaccacctggacctcgatgcttgtgtgtggctggaagaggaacttaagactttcaag
cgcatcctggtcctggtgtcccattcccaggacttcctgaatggggtctgtaccaatatc
atccatatgcacaacaagaaactcaagtattacacgggtaattatgatcagtatgtgaag
acacggctggagttggaagagaaccagatgaagaggtttcactgggagcaggaccagatc
gcacacatgaagaactacattgccaggtttggccatggcagtgccaagctggcccggcag
gcccaaagcaaagagaaaacactacagaaaatgatggcatccggactgacagaaagggtt
gtgagtgacaagacgctgtcattttatttcccaccgtgcggtaagatcccaccacctgtc
attatggtgcagaacgtgagcttcaaatatacgaaagacgggccttgcatctacaataat
ctagaatttggtattgatcttgacacacgagtggctctggtaggacccaatggagcaggg
aagtccactctgctgaagctgctaaccggagagcttctgcctacagatggaatgatccgg
aagcattctcatgtcaagatagggcgttaccatcagcacttacaggagcagctggacctt
gacctttcaccattggaatacatgatgaagtgctatccagagatcaaggagaaggaggag
atgaggaagatcattgggagatacggcctcactgggaaacagcaggtgagcccaatccgg
aacctgtcggatgggcagaagtgccgagtgtgcctggcctggctggcctggcagaaccct
cacatgctctttctggacgagcctaccaatcacctggacatcgagaccattgatgctctg
gcagatgccatcaatgagtttgagggtggaatgatgctagtcagccatgacttcagactc
atccagcaggttgcacaggagatttgggtctgtgagaaacagacaatcaccaagtggcct
ggagacatcctggcctacaaggagcacctcaagtccaagctggtagatgaggagccccag
ctcaccaagaggacccacaatgtgtga

DBGET integrated database retrieval system