KEGG   Mus musculus (mouse): 27410
Entry
27410             CDS       T01002                                 

Gene name
Abca3, 1810036E22Rik, ABC-, ABC-C, Abc, Abc3
Definition
(RefSeq) ATP-binding cassette, sub-family A (ABC1), member 3
  KO
K05643  ATP-binding cassette, subfamily A (ABC1), member 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    27410 (Abca3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    27410 (Abca3)
Transporters [BR:mmu02000]
 ABC transporters, eukaryotic type
  ABCA (ABC1) subfamily
   ABCA1, 2, 3, 4, 7, 12, 13 subgroups
    27410 (Abca3)
SSDB
Motif
Pfam: ABC2_membrane_3 ABC_tran AAA_21 RsgA_GTPase AAA_23 AAA_15 AAA_30 AAA_22 AAA_29 MukB
Other DBs
NCBI-GeneID: 27410
NCBI-ProteinID: NP_001034670
MGI: 1351617
Ensembl: ENSMUSG00000024130
Vega: OTTMUSG00000031259
UniProt: Q8R420 Q6AXE3
Position
17; 17 A3.3
AA seq 1704 aa
MAVLRQLTLLLWKNYTLKKRKVLVTVLELFLPLLFSGILIWLRLKIQSENVPNATVYPDQ
SIQELPLFFSFPPPGGTWELAYVPSHSDAARTITETVKREFMIKMRVHGFSSEKDFEDYI
RYDNHSSSVLAAVVFEHSFNHSQDPLPLAVKYHLRFSYTRRNYMWTQTGNIFLKETEGWH
TTSLFPLFPSPGPREPSSPDGGEPGYIREGFLAMQHAVDKAIMRYHANTSAQQLFQKLMV
ITKRFPFPPYISDPFLIAIQYQLPLLLMLSFTYTSLTIIRAVVQEKEKKLKEYMRMMGLN
SWLHWSAWFLMFFLFFLIVVSFMTLLFCVKVKKDIAVLSNSDPSLVLAFLLCFAISSISF
SFMVSTFFSKANIAAAVGGFLYFFTYTPYFFVAPRYNWMTLSQKLLSCLLSNVAMAMGAQ
LIGKFEAKGTGIQWRDLLNPVNVDDNFCFGQVLGMLLLDSALYGLVTWYVEAVFPGQFGV
PQPWHFFLMPSYWCGNPRTVVGKEEEGSDPEKALRNEYFEAEPEDLVAGIKIKHLSKVFQ
VGNKDKMGIRDLTLNLYEGQITVLLGHNGAGKTTTMSLLTGLFPPTSGHAYIHGYEISQD
MAQIRKSLGLCPQHDVLFDNLTVAEHLYFYAQLKGLSLQKCPEEVKQMLHILSLEDKRDL
RSKFLSGGMKRKLSIGIALIAGSKVLMLDEPTSGMDAVSRRAIWDLLQQQKSDRTVLLTT
HFMDEADLLGDRIAILAKGELQCCGSSLFLKQKYGAGYHMTLVKEPHCNPEGISQLVHHH
VPNAMLESHAGAELSFILPKESTHRFESLFAKLEKKQKELGIASFGASVTTMEEVFLRVG
KLVDTSMDIQAIQLPALQYQHERRASDWALDSNLCGVMDPTNGIGALIEEEEVLVKLNTG
LALHCQQFWAMFLKKAAYSWREWKMVAAQVLVPLTCLTLALLAIHYTSEIFDDPLLKLSL
NEYGRTVVPFSVPGTSRLAQQLSENLRDMLQAERQEPREVLGDLEEFLVFRASVEGGGFN
ERCLVATSFKDRGELTVVTALFNNQAYHSPATALAIVDNLLFKLLCGPQASIEISNYPQP
RNTLQVAKDHFNEGRKGFDIALNLLIAMAFLASTFSILAVSERAVQAKHVQFVSGVHVAT
FWFSALLWDLISFLVPSLLLLVVFQAFNVHAFTRDGHMADLLLLLMLYGWAIIPLMYLMS
FFFSAASTAYTRLTIFNILSGIATFIMVTIMRIPAVKLEELSRTLDHVFLVLPNHCLGMA
VSNFYENYETRRYCTSSELAAHYCKKYNIQYQESFYAWSTPGVGKFVTSMAASGGIYLTL
LFLIETNLLWRLRTFICAFRRRWTLAELQNRTSVLPEDQDVAEERSRILVPSLDSMLDTP
LIINELSKVYDQRAPLLAVDRISLAVQKGECFGLLGFNGAGKTTTFKMLTGEETITSGDA
FVGGYSISSDIGKVRQRMGYCPQFDALLDHMTGREMLVMYARLRGIPERLINACVENTLR
GLLLEPHANKLVKTYSGGNKRKLSTGIALIGEPAVIFLDEPSTGMDPVARRLLWDTVARA
RESGKAIVITSHSMEECEALCTRLAIMVQGQFKCLGSPQHLKSKFGSGYSLQAKVRSEGK
QDALEEFKAFVDLTFPGSILEDEHQDMVHYHLPGCDLSWAKVFGILEKAKEKYGVDDYSV
SQISLEQVFLSFAHLQPPTTEDGR
NT seq 5115 nt   +upstreamnt  +downstreamnt
atggcagtgctgcggcagctcaccctcctactctggaagaactataccctgaagaaacgg
aaggttctagtgacagtcctggagctcttcctgcccctgctgttttctgggatcctgatt
tggcttcgcttgaagatccagtcggagaatgtgcccaatgccactgtttacccggaccag
tccatccaggagctgcccctgtttttctcattccctccacctggggggacctgggagctc
gcctatgtcccttcccacagcgatgctgccaggaccatcacggagacggtgaaaagggaa
ttcatgatcaagatgagagtgcacggcttctcctctgagaaggacttcgaggactacatt
cgctatgacaaccactcctccagcgtgctggcagctgtggtatttgagcacagcttcaac
cacagccaggaccccctgccgctggcggtgaaataccacctgcgcttcagttacacacga
agaaattacatgtggacccaaacaggaaatattttcctaaaagagactgaaggctggcat
accacttcactttttccactttttccaagccccggaccgcgggaaccttcatcacctgat
ggcggtgaacctggatacattcgggaaggcttcctggccatgcaacatgctgtagacaaa
gccatcatgcgttaccatgccaacacctctgcacagcagctgttccagaagctcatggtg
atcaccaaaaggttcccgttcccaccatacatctcagatccattcctcattgccatccag
taccagcttcctctgctgctcatgctgagtttcacctacacctccctcaccatcatccgg
gctgtggtgcaggagaaggagaaaaaactaaaggagtacatgcgcatgatggggcttaac
agctggctacactggagcgcttggttcctcatgttcttcctattcttcctcatcgtggtc
tccttcatgaccctcctgttctgtgtcaaagtgaagaaggacatagcagtcctttccaac
agcgacccctccctggtcctggcgttcctgctgtgttttgcaatctcctccatttccttc
agcttcatggtcagcaccttcttcagtaaagccaacatagcagcagccgtgggtggcttc
ctgtacttcttcacctataccccctactttttcgtggctcctcggtacaactggatgaca
ctgagtcaaaagctcttgtcctgtctcctatctaatgttgccatggcaatgggagcccag
ctcataggaaaattcgaagccaaaggcactggcatccagtggcgggacctcctcaaccct
gtcaacgtggacgacaatttctgctttggacaagtgctggggatgctgctgctggactca
gcactctatggcctggtgacctggtacgtggaggctgtcttcccaggccagtttggcgta
ccccagccctggcacttcttccttatgccctcctactggtgtgggaacccaagaactgtc
gtagggaaggaagaggaaggcagcgacccagagaaagctctcaggaacgagtactttgaa
gccgagccagaggacttggtagctggaatcaagatcaagcatctctccaaggtgttccaa
gtgggcaataaggacaagatgggcatcagagacctgaccctgaacctctacgaaggacag
ataacagtcctcctgggccacaatggtgctgggaagaccacgaccatgtctctgctgaca
ggcctcttcccccctaccagtggacatgcttatattcatgggtacgaaatttcccaagac
atggctcagatccgcaagagtttgggcctgtgtccccagcatgatgtactgtttgacaac
ctgacagttgccgaacatctttacttctatgcacagctgaaaggcctctctctccagaag
tgtcctgaggaagtcaagcagatgctacacatcctcagcctggaggacaagcgtgactta
cggtccaagttcctgagtgggggcatgaagcgcaagctctccattggcatcgccctcata
gcgggctctaaggtgctgatgttagatgagcccacctcaggcatggatgcagtgtccaga
agggccatctgggaccttctccagcagcagaagagtgaccgcaccgtcctgctgaccact
cacttcatggacgaagctgacctgctgggagaccgcatcgccatcttggccaagggggag
ctccagtgctgcgggtcttcactatttctcaagcagaaatacggagctggctaccacatg
acgctggtaaaagaaccgcactgcaatcctgaaggaatctctcagctggtgcaccaccat
gtccccaatgccatgctggagagccatgctggggctgagctgtcctttattcttcccaag
gagagcacgcacaggtttgaaagtctgtttgctaaactggaaaagaagcagaaggagttg
ggcatcgcaagcttcggggcctcggtcaccaccatggaggaagtcttccttcgggttggt
aagctggtggacaccagcatggacattcaagccattcagcttcctgctctgcagtaccag
catgagaggcgggcaagcgactgggctttggacagtaacctgtgtggggtgatggaccca
acgaatggcattggagccctcatagaggaagaggaagttttggtcaagctcaacacaggg
cttgccctccactgccagcagttctgggccatgttcctgaagaaggctgcatacagctgg
cgggaatggaagatggtggcagctcaggtcctggtccccctgacctgcctcaccctggcc
ctcctggctatccactacacctcagagatctttgatgaccctctcctgaagctaagcctg
aacgagtatggtagaacggttgtgcccttctcggtcccaggcacatccaggctggctcag
cagctgtctgagaatctaagggacatgctgcaggctgagaggcaggagccccgggaagtg
ctaggtgacctagaggagttcctggttttcagggcctcagtggaaggaggcggctttaat
gagcggtgcctagtagcaacatccttcaaagacagaggagagctgaccgtggtcactgcc
ctgttcaacaaccaggcataccactccccagccactgccctggccatcgtggacaacctt
ctgttcaagctattgtgtggccctcaggcctccattgagatctccaactacccccagccc
cggaacaccctgcaggtcgccaaggaccacttcaatgagggccggaagggatttgacatt
gccctcaatttgctcatcgccatggcatttctggccagcaccttttccatcctggctgtc
agtgagagggccgtccaggccaagcacgttcagtttgtgagcggtgtccatgtggctact
ttctggttctccgctctgttgtgggacctcatctccttcctcgttcccagtctactactt
ctggtggtgttccaagccttcaatgtgcacgccttcacgagggatggtcacatggctgac
ctgctgctgctgctcatgctctacggctgggccatcatccccctcatgtacctcatgagc
ttcttcttctcggctgcgtccacagcttataccaggctgaccatattcaacatcctgtcg
ggcatcgctaccttcatcatggtcactatcatgcgtatcccagctgtgaagttagaagaa
ctttccagaaccttagatcatgtgttcttggtgctgccaaaccactgcctggggatggcg
gtcagcaacttctatgagaactatgagactcggcgatactgcacttcctcagagcttgct
gcccactactgcaagaagtacaacatccagtaccaggagagcttctatgcctggagcacc
ccaggcgtgggcaagtttgtgacttccatggctgcctcagggggcatctacctcaccctg
ctgttcctcattgagaccaacctgctgtggcgactgagaaccttcatctgtgccttccgg
aggaggtggactctggcagaactgcagaaccggacatcagtgctgcccgaggaccaggat
gtagctgaggagaggagccgaatcctggtccctagcttggactccatgctcgacacacca
ctgatcatcaacgagctctccaaggtgtatgaccagcgagcaccgctccttgccgtggac
aggatctcccttgcggtccagaaaggggagtgcttcggcctgttgggtttcaatggagct
ggaaaaaccacaacattcaaaatgctgactggggaggagaccatcacctcaggggatgcc
tttgttggtggttacagcatcagttctgacatcgggaaggtgcggcagcggatgggctac
tgcccccagtttgatgcactgcttgatcacatgactggcagggagatgctggttatgtat
gcacggctccgaggcatcccagagcggctcatcaatgcctgtgtggagaatactctgcgg
ggtctgctgctggaaccgcacgccaacaaactagtcaagacttacagtggtggtaacaaa
cgcaagctaagcactggcattgccctcattggagagcctgcagtcatcttcctggatgag
ccatcgaccggcatggacccagtggcccggcgtctactctgggatactgtagcccgggcc
cgagagtctggcaaagccattgtcatcacctcccacagtatggaggagtgtgaagcctta
tgtaccaggctggccatcatggtacagggccagttcaagtgcctgggcagcccacagcac
ctcaagagcaagtttggcagcggctactccctgcaggccaaggtccggagcgaggggaag
caagacgcgctagaggagttcaaggcctttgtggacctgaccttcccaggcagcatccta
gaagatgagcaccaagacatggtccattatcatctgcctggctgtgacctcagctgggcc
aaggtatttggtatcctggagaaagccaaggagaagtatggagtggatgattactctgtg
agccagatctccctggagcaggtctttctgagctttgcccacctacaaccccccaccact
gaggatggccggtga

DBGET integrated database retrieval system