KEGG   Mus musculus (mouse): 27412
Entry
27412             CDS       T01002                                 

Symbol
Peg12, Frat3
Name
(RefSeq) paternally expressed 12
  KO
K03069  frequently rearranged in advanced T-cell lymphomas 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04310  Wnt signaling pathway
mmu05010  Alzheimer disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05200  Pathways in cancer
mmu05224  Breast cancer
mmu05225  Hepatocellular carcinoma
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    27412 (Peg12)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    27412 (Peg12)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    27412 (Peg12)
   05226 Gastric cancer
    27412 (Peg12)
   05224 Breast cancer
    27412 (Peg12)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    27412 (Peg12)
   05022 Pathways of neurodegeneration - multiple diseases
    27412 (Peg12)
SSDB
Motif
Pfam: GSK-3_bind
Other DBs
NCBI-GeneID: 27412
NCBI-ProteinID: NP_038816
MGI: 1351637
Ensembl: ENSMUSG00000070526
Vega: OTTMUSG00000059567
UniProt: Q9WVA7
Position
7:complement(62111619..62114258)
AA seq 283 aa
MPCRREEEAGDEAEGEEDDNSFLLLQQSVTLGGSADVDRLIAQIGETLQLDARHDGPASP
CAAPGPPPAPPRVLAALPADKAGAPARRLLRRAASAEAGDPAPPGAVRCVLGERGRLRGR
AAPYCVAEIAPGASALPQQLGLEVSPGMGKVSIPQPLSGRCRRGWLRNAAASRRQQQRRG
SQSETRTSDGDPPRLLQQLLLSGNLIKEAVRRLHSRGLQLQAKLPAHSFLGPLSAPVHEP
PLPGSPRAACSDPGDCDGGHSSELGTTFLSLAANNPGGHSTNL
NT seq 852 nt   +upstreamnt  +downstreamnt
atgccgtgccggagggaagaggaagccggcgacgaggcggagggggaggaggacgacaac
agcttcctcctgctgcagcagtccgtgactctggggggctctgccgacgtggaccggctc
atcgcccagatcggcgagacgctgcagctggacgccaggcacgatggcccggcctcgcca
tgtgctgccccgggccccccgcccgcgcccccgcgggtcctggccgcgctgccggcggac
aaggccggggccccagcgaggcggctgctacggagagcagcatcagcggaggccggggac
cctgcgcccccgggggctgtgcgctgcgtgctgggggagcgcgggcgcctgcggggccgg
gcggcgccctactgtgtggcggagatcgccccgggcgccagcgcgctgccccagcagctc
ggccttgaggtatccccggggatgggcaaagtaagcatcccgcagccactgtccggccgg
tgccggcggggttggctccggaacgcagccgcgtcccgccgccagcaacagcgacgcgga
tctcagtcggagacccgcacgagtgacggcgacccgccccgactcctgcagcagctcctt
ctttcgggaaacctcatcaaggaggcggtgcggagacttcattcgcgagggctacagcta
caggcaaagcttcccgctcactcgttcctcgggcctttgtcagccccggtgcatgagccg
cctttgcccgggagcccccgtgcagcctgcagcgaccctggcgattgtgatggagggcac
agctcagaactagggacgaccttcttgtccctggcagctaataaccccggtggccacagc
accaacctgtag

DBGET integrated database retrieval system