KEGG   Mus musculus (mouse): 27416Help
Entry
27416             CDS       T01002                                 

Gene name
Abcc5, 2900011L11Rik, AI132311, Abcc5a, Abcc5b, Mrp5
Definition
(RefSeq) ATP-binding cassette, sub-family C (CFTR/MRP), member 5
  KO
K05668  ATP-binding cassette, subfamily C (CFTR/MRP), member 5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01523  Antifolate resistance
mmu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    27416 (Abcc5)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    27416 (Abcc5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    27416 (Abcc5)
Transporters [BR:mmu02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC1, 2, 3, 4, 5, 6, 10, 11, 12, 13 subgroups
    27416 (Abcc5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ABC_tran ABC_membrane SMC_N AAA_29 MMR_HSR1 AAA_23 Dynamin_N RsgA_GTPase AAA_24 AAA_7 TsaE AAA_13 LVIVD cobW
Motif
Other DBs
NCBI-GeneID: 27416
NCBI-ProteinID: NP_038818
MGI: 1351644
Ensembl: ENSMUSG00000022822
Vega: OTTMUSG00000025954
UniProt: Q9R1X5
Position
16 A3; 16 12.41 cM
AA seq 1436 aa AA seqDB search
MKDIDMGKEYIIPSPGYRSDRDRSAVPGQHRDPEEPRFRRTRSLECQDALETAARVEGLS
LDISVHSHLQILDEEHSKGKYHHGLSVLKPFRTTTKHQHPVDNAGLFSYMTFSWLSPLAR
VVHKKGELLMEDVWPLSKYESSDVNSRRLERLWQEELNEVGPDAASLRRVVWIFCRTRLI
LSIVCLMITQLAGFSGPAFVVKHLLEYTQATESNLQYSLLLVLGLLLTEVVRSWSLALTW
ALNYRTGVRLRGAILTMAFKKILKLKNIKEKSLGELINICSNDGQRMFEAAAVGSLLAGG
PVVAILGMIYNVIILGPTGFLGSAVFILFYPAMMFVSRLTAYFRRKCVAATDDRVQKMNE
VLTYIKFIKMYAWVKAFSQCVQKIREEERRILEKAGYFQSITVGVAPIVVVIASVVTFSV
HMTLGFHLTAAQAFTVVTVFNSMTFALKVTPFSVKSLSEASVAVDRFKSLFLMEEVHMIK
NKPASPHIKIEMKNATLAWDSSHSSIQNSPKLTPKMKKDKRATRGKKEKSRQLQHTEHQA
VLAEQKGHLLLDSDERPSPEEEEGKQIHTGSLRLQRTLYNIDLEIEEGKLVGICGSVGSG
KTSLVSAILGQMTLLEGSIAVSGTFAYVAQQAWILNATLRDNILFGKEFDEERYNSVLNS
CCLRPDLAILPNSDLTEIGERGANLSGGQRQRISLARALYSDRSIYILDDPLSALDAHVG
NHIFNSAIRKRLKSKTVLFVTHQLQYLVDCDEVIFMKEGCITERGTHEELMNLNGDYATI
FNNLLLGETPPVEINSKKEATGSQKSQDKGPKPGSVKKEKAVKSEEGQLVQVEEKGQGSV
PWSVYWVYIQAAGGPLAFLVIMVLFMLNVGSTAFSTWWLSYWIKQGSGNSTVYQGNRSFV
SDSMKDNPFMQYYASIYALSMAVMLILKAIRGVVFVKGTLRASSRLHDELFRRILRSPMK
FFDTTPTGRILNRFSKDMDEVDVRLPFQAEMFIQNVILVFFCVGMIAGVFPWFLVAVGPL
LILFSLLHIVSRVLIRELKRLDNITQSPFLSHITSSIQGLATIHAYNKRQEFLHRYQELL
DDNQAPFFLFTCAMRWLAVRLDLISIALITTTGLMIVLMHGQIPSAYAGLAISYAVQLTG
LFQFTVRLASETEARFTSVERINHYIKTLSLEAPARIKNKAPPHDWPQEGEVTFENAEMR
YRENLPLVLKKVSFTIKPKEKIGIVGRTGSGKSSLGMALFRLVELSGGCIKIDGIRISDI
GLADLRSKLAIIPQEPVLFSGTVRSNLDPFNQYTEDQIWDALERTHMKECIAQLPLKLES
EVMENGDNFSVGERQLLCIARALLRHCKILILDEATAAMDTETDLLIQETIREAFADCTM
LTIAHRLHTVLGSDRIMVLAQGQVVEFDTPSVLLSNDSSRFYAMFAAAENKVAVKG
NT seq 4311 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatattgacatgggaaaagaatatatcatccccagccctgggtacagaagtgac
agggacagaagcgctgtaccagggcaacacagagaccccgaggaacccaggttccggaga
acaagatcgttggaatgccaagatgctctcgaaacagcagcccgagttgaggggctttcc
ctggatatctctgtgcattctcatctccaaattctggacgaggagcattctaagggaaaa
taccaccatggtttaagtgtcctgaagcccttccggaccactaccaagcaccagcaccca
gtggacaatgctggacttttctcctacatgaccttttcatggctctctcctctggcccga
gtggttcacaagaagggggagctgttaatggaggatgtgtggcctttgtccaagtatgag
tcttctgatgtgaacagcagaagactagagagactgtggcaagaagagctgaatgaagtt
gggccagacgctgcctccctgcgaagggttgtgtggatcttttgccgcaccaggctcatc
ctgtccatcgtgtgcctgatgatcacgcagttggctggcttcagtggaccagccttcgtg
gtgaagcacctcttggagtacacccaggcaacagagtctaacctgcagtacagcttgctg
ttagtgttaggcctactcctgacagaagttgtacgctcctggtcacttgcactgacttgg
gcattgaattatcgaactggtgtccggttgcggggggctatcctgactatggcattcaag
aagatcctgaagttaaagaacattaaagaaaagtccctaggggagctcatcaatatctgc
tccaatgatgggcaaaggatgtttgaggcagccgctgtgggcagcttgctggctggagga
cctgttgttgccatcttgggcatgatttataatgtaatcatcctaggacccacgggcttc
ctgggatcagcggtttttatcctcttttatccagcaatgatgttcgtgtcacggctaact
gcatatttcaggagaaagtgtgtagctgccacagatgaccgtgtccagaagatgaatgaa
gttcttacctacattaaattcattaaaatgtatgcctgggtcaaagcgttttctcagtgt
gtgcaaaaaatccgagaggaggaacgtcggatattggagaaagccgggtactttcagagc
atcactgttggagtggctcctattgtggtagtgatcgccagtgtggtgacgttctccgtt
cacatgaccctgggcttccatctgactgcggcacaggccttcacagtggtgactgtcttc
aattccatgacttttgctttaaaagtaacaccattctcagtgaagtccctctctgaagca
tcagtggctgttgacagatttaagagtttgtttctaatggaagaggttcacatgataaag
aacaaaccggccagtcctcacatcaagatagagatgaaaaatgccaccttggcatgggac
tcctcccactccagtatacagaactcgcccaagctgacccccaaaatgaaaaaagacaag
agggctaccaggggcaagaaagagaagtcgaggcagctgcaacacactgagcaccaggcg
gtgctggcagaacagaaaggacacctcctcctggacagtgacgagcggcccagcccggaa
gaggaagaaggcaagcagatccacacagggagcctgcgcctgcagaggacactgtacaac
attgacttagaaattgaagagggcaaactggttggaatctgcggcagtgtgggaagtgga
aaaacctctctcgtttcagccattttaggccagatgacgcttttggagggcagcattgcc
gtcagtgggacctttgcttatgtggcccaacaggcctggattctcaatgccactctgaga
gacaacattctctttgggaaggaatttgatgaagagagatacaactcagtgctgaatagc
tgctgcctgcggcctgacttggccattctccccaacagcgacctgactgagattggagag
cgaggagccaacctgagtggtggacagcgccagagaatcagccttgctagagccttgtac
agtgatagaagcatctacatcctggatgaccccctcagtgccttagatgcccatgtgggc
aaccacatcttcaacagtgctatccggaagcgcctcaagtctaagacggttctgtttgtt
acacaccagttacagtatctggtcgattgtgatgaggtgatcttcatgaaggaaggctgt
atcacagagagaggtacccatgaggagctgatgaacttaaatggggattacgctacgatt
tttaataacctgttgctgggagagacacccccagttgagattaattcgaaaaaggaagct
actggttcacaaaaatcacaagacaagggccctaagccagggtcagtgaagaaggagaag
gcggtgaagtcggaggaagggcagcttgtgcaggtggaggagaaagggcaaggttctgtg
ccttggtcagtctactgggtctacatccaggctgcagggggccccttggctttcctggtc
atcatggtcctcttcatgctgaatgtgggcagcactgccttcagcacctggtggcttagc
tactggatcaagcaaggaagcgggaacagcacagtgtatcaagggaacagaagcttcgtg
agtgacagcatgaaggacaaccccttcatgcagtactacgccagcatctacgccctctcc
atggcagtcatgctgatcttgaaagccattcgaggagttgtcttcgtcaagggcacactg
agagcctcctcccggctccatgatgagctattccgaaggatccttaggagccccatgaag
ttttttgatactaccccaacaggaaggattctcaacaggttttccaaagacatggatgaa
gtggatgtgcggctgccgttccaggctgagatgtttattcagaatgtaatcctggtgttc
ttctgtgttggaatgattgctggagtcttcccatggttcctcgtggcggtggggcctctc
ctcatcctcttctcacttctccacattgtctccagggtcctgattcgtgagctaaagcgg
ttggacaatatcacgcagtctcctttcctctcccacatcacgtctagcattcagggcctg
gccaccatccatgcctacaacaaaaggcaggagtttttacacaggtatcaggagctcctg
gatgacaaccaggctccctttttcctgttcacctgtgcaatgaggtggctggcagtgcgg
ctggacctcatcagcattgccctgattaccaccactggcctgatgattgttctcatgcat
ggacagatcccttcagcctatgcggggcttgccatctcctacgctgtgcagttaactgga
ctattccagttcaccgtcagactggcatcggagacagaagcacggttcacttccgtggag
aggatcaaccactatatcaagactctctctttggaagcacctgccagaatcaagaacaag
gctcctccccatgactggccccaggagggagaagtaacctttgagaatgcagaaatgaga
taccgggaaaatctccctctggtccttaagaaagtgtccttcaccatcaagcccaaggaa
aagataggcattgtgggacgaacagggtcagggaagtcctctttggggatggccctcttc
cgtctggtggagctatctggaggctgcatcaagattgatggaataagaatcagtgacatc
ggcctggccgacctccgaagcaaactggccatcattcctcaggagccagtgctgttcagt
ggcactgtcagatcaaacctggaccctttcaaccagtacacggaagaccagatctgggat
gctctagagagaacgcacatgaaggaatgtattgcccagctacctctgaaacttgagtct
gaagtaatggagaacggggacaacttctctgttggggaacggcagctgttgtgcatagca
agagccctgctgcgtcactgtaagattctgattttagatgaagctacagccgctatggac
acagagacagacttactgatccaggagaccatccgggaagcatttgcggactgcaccatg
ctgaccattgcccatcgcctgcacacagttctgggctctgacaggatcatggtgctggcc
cagggacaggtggtggagtttgacaccccatcggtccttctgtctaatgacagttcaaga
ttctatgccatgtttgctgctgcagagaacaaggtggctgtcaagggctga

DBGET integrated database retrieval system