KEGG   Mus musculus (mouse): 27418
Entry
27418             CDS       T01002                                 

Gene name
Mkln1, A130067F06Rik, AU015903, BB154892
Definition
(RefSeq) muskelin 1, intracellular mediator containing kelch motifs
  KO
K23337  muskelin
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    27418 (Mkln1)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   CTLH complex
    27418 (Mkln1)
SSDB
Motif
Pfam: Muskelin_N Kelch_3 Kelch_1 Kelch_6 Kelch_4 Kelch_5 F5_F8_type_C Kelch_2 Sad1_UNC
Other DBs
NCBI-GeneID: 27418
NCBI-ProteinID: NP_038819
MGI: 1351638
Ensembl: ENSMUSG00000025609
Vega: OTTMUSG00000014731
UniProt: O89050 Q3UWT3
Structure
PDB: 
4PQQ

Position
6; 6 A3.3
AA seq 735 aa
MAAGGAVAVAPECRLLPYALHKWSSFSSTYLPENILVDKPNDQSSRWSSESNYPPQYLIL
KLERPAIVQNITFGKYEKTHVCNLKKFKVFGGMNEENMTELLSSGLKNDYNKETFTLKHK
IDEQMFPCRFIKIVPLLSWGPSFNFSIWYVELSGIDDPDIVQPCLNWYSKYREQEAIRLC
LKHFRQHNYTEAFESLQKKTKIALEHPMLTDMHDKLVLKGDFDACEELIEKAVNDGLFNQ
YISQQEYKPRWSQIIPKSTKGDGEDNRPGMRGGHQMVIDVQTETVYLFGGWDGTQDLADF
WAYSVKENQWTCISRDTEKENGPSARSCHKMCIDIQRRQIYTLGRYLDSSVRNSKSLKSD
FYRYDIDTNTWMLLSEDTAADGGPKLVFDHQMCMDSEKHMIYTFGGRILTCNGSVDDSRA
SEPQFSGLFAFNCQCQTWKLLREDSCNAGPEDIQSRIGHCMLFHSKNRCLYVFGGQRSKT
YLNDFFSYDVDSDHVDIISDGTKKDSGMVPMTGFTQRATIDPELNEIHVLSGLSKDKEKR
EENVRNSFWIYDIVRNSWSCVYKNDQATKDNLSKSLQEEEPCPRFAHQLVYDELHKVHYL
FGGNPGKSCSPKMRLDDFWSLKLCRPSKDYLLRHCKYLIRKHRFEEKAQMDPLSALKYLQ
NDLYITVDHSDPEETKEFQLLASALFKSGSDFTALGFSDVDHTYAQRTQLFDTLVNFFPD
SMTPPKGNLVDLITL
NT seq 2208 nt   +upstreamnt  +downstreamnt
atggcggctggcggggctgttgctgtggcgccggagtgccggcttctgccctacgcgctg
cataagtggagctccttctcctccacctaccttcccgagaacattttagtggataaacca
aatgatcagtcttccagatggtcttcagagagcaactatcctccccaatacttgattctg
aagcttgaaaggcctgctatcgttcagaatattacatttggaaaatatgagaaaactcat
gtctgcaatttgaagaaattcaaagtttttggtggaatgaatgaagaaaatatgacagag
ctgttgtccagtggcctgaagaatgattataacaaagagacatttaccttgaaacataaa
attgatgaacagatgttcccttgtcgattcattaaaattgttccacttttgtcctggggg
cccagctttaactttagcatctggtatgttgaacttagtggcattgatgatcctgatatc
gtgcagccctgtctgaactggtacagcaagtaccgtgaacaggaagccattcgcctttgc
ctaaaacacttcagacaacataactatacagaggcttttgaatccctgcagaagaaaacc
aagattgcactggaacatccaatgttgacagatatgcatgacaaattggtgttaaagggt
gactttgatgcttgcgaggagttgattgaaaaagctgtaaatgatggcttgttcaatcag
tatatcagtcaacaggagtataagccacggtggagtcagattattcctaagagcaccaaa
ggcgatggagaagataacagaccaggaatgagagggggccatcaaatggtcattgacgtc
cagacagagactgtttatttgtttggtggctgggatggaacacaagatcttgctgacttc
tgggcatacagtgtgaaggagaaccagtggacatgtatttctagagacactgagaaagag
aatggtccgagtgccagatcgtgtcataagatgtgcattgacattcagcggagacaaatc
tacacattgggccgttacttggattcctctgtgaggaacagcaaatctctgaaaagtgat
ttctaccgttacgacattgacactaatacctggatgttactaagtgaagatactgctgcc
gacggtggaccaaagttggtgtttgatcatcagatgtgtatggactcagaaaaacatatg
atctacacgtttggtggcaggattttgacgtgtaatggcagtgtagatgacagcagagcc
agtgagccacaattcagtgggttgtttgcgttcaactgccagtgtcaaacttggaaactt
cttcgagaggattcctgtaatgctggccctgaggacatccagtctcggattggacactgc
atgctgttccactcaaaaaaccgttgcttatatgtgtttggtggccagagatccaagacc
tatttgaatgatttctttagttatgatgtggactcagatcatgtagacataatttcagat
ggcaccaagaaagactctggaatggttccaatgaccggattcacacagagagcaactatt
gatccagaactgaatgaaatacatgtcttatccggacttagcaaagacaaagaaaagagg
gaagagaatgtcagaaattcattctggatttatgacattgtgaggaatagctggtcttgt
gtctataagaatgatcaagctacaaaagataatctgagtaaaagtcttcaggaggaagaa
ccatgtccaaggtttgcccatcaactcgtttatgatgaattacacaaggttcattattta
tttggtggaaatccaggaaaatcttgctctccaaagatgagactagatgacttctggtca
ctgaagttgtgtagaccttcaaaagactacttactgaggcattgcaagtacctcataaga
aaacacaggtttgaagaaaaggcccaaatggatccccttagtgctctgaagtatttacaa
aatgatctttatataactgtggatcattcggacccagaagagacaaaagagtttcaactc
ctagcctcagctctgttcaaatctggctcagatttcacagctctaggcttttcagatgtg
gatcatacctatgctcaaagaactcagctctttgacaccttagtaaatttctttcctgac
agcatgactcctcctaaaggcaacctggtagacctgatcacactgtag

DBGET integrated database retrieval system