KEGG   Mus musculus (house mouse): 27419
Entry
27419             CDS       T01002                                 
Symbol
Naglu
Name
(RefSeq) alpha-N-acetylglucosaminidase (Sanfilippo disease IIIB)
  KO
K01205  alpha-N-acetylglucosaminidase [EC:3.2.1.50]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00531  Glycosaminoglycan degradation
mmu01100  Metabolic pathways
mmu04142  Lysosome
Module
mmu_M00078  Heparan sulfate degradation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    27419 (Naglu)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    27419 (Naglu)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    27419 (Naglu)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.50  alpha-N-acetylglucosaminidase
     27419 (Naglu)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   27419 (Naglu)
SSDB
Motif
Pfam: NAGLU NAGLU_C NAGLU_N
Other DBs
NCBI-GeneID: 27419
NCBI-ProteinID: NP_001412412
MGI: 1351641
Ensembl: ENSMUSG00000001751
Position
11:100960918..100968483
AA seq 538 aa
MGNLHTWDGPLPRSWHLSQVYLQHRILDRMRSFGMIPVLPAFAGHVPKAITRVFPQVNVI
KLGSWGHFNCSYSCSFLLAPGDPMFPLIGNLFLRELTKEFGTDHIYGADTFNEMQPPFSD
PSYLAATTAAVYEAMVTVDPDAVWLLQGWLFQHQPQFWGPSQIRAVLEAVPRGRLLVLDL
FAESHPVYMHTASFHGQPFIWCMLHNFGGNHGLFGALEDVNRGPQAARLFPNSTMVGTGI
APEGIGQNEVVYALMAELGWRKDPVPDLMAWVSSFAIRRYGVSQPDAVAAWKLLLRSVYN
CSGEACSGHNRSPLVKRPSLQMSTAVWYNRSDVFEAWRLLLTAAPNLTTSPAFRYDLLDV
TRQAVQELVSLCYEEARTAYLKQELDLLLRAGGLLVYKLLPTLDELLASSSHFLLGTWLD
QARKAAVSEAEAQFYEQNSRYQITLWGPEGNILDYANKQLAGLVADYYQPRWCLFLGTLA
HSLARGVPFQQHEFEKNVFPLEQAFVYNKKRYPSQPRGDTVDLSKKIFLKYHPQPDSL
NT seq 1617 nt   +upstreamnt  +downstreamnt
atgggtaacttgcacacctgggatggccccctgccccgttcctggcacctcagtcaagtc
tacctgcagcatcgaatcctggaccggatgcgctcctttggcatgatcccagtgctgcct
gccttcgcagggcatgtccccaaggccatcaccagggtgtttccacaggtcaatgtcatc
aagttggggagctggggacatttcaactgctcctacagctgctccttccttctggctcca
ggagaccccatgtttcccctcatcgggaacctcttcctacgggagctgaccaaggagttt
ggcacagatcatatctatggggctgacaccttcaatgagatgcagcctcccttctctgac
ccctcctacctcgccgctaccactgcagccgtctatgaagccatggtcactgtggaccct
gatgctgtttggctgctccaaggctggctcttccagcaccagccccagttctggggcccc
tctcaaatcagggctgtgctggaggccgtgccccgtggtcgtctcctggttctggacctg
tttgctgaaagccatcctgtttacatgcacacagcctccttccatggccagcccttcatc
tggtgtatgctccacaactttgggggcaaccatggcctgtttggagccctcgaggatgtg
aaccgaggcccccaggcagctcgcctcttccctaactccaccatggtcggcactggcata
gcccccgagggcattggccagaatgaagtggtctatgctctcatggctgagctgggctgg
cgcaaggaccctgtaccagatttgatggcctgggtgagcagctttgccatccgccgatac
ggggtctcccagcctgatgccgtggcagcttggaagctcctactcagaagtgtctacaac
tgctctggggaggcgtgcagtgggcacaatcgaagcccgttggtcaagcggccgtcccta
cagatgagtaccgctgtctggtacaacagatcagatgtgtttgaggcttggcgactgctg
ttaacagctgccccaaacctgaccaccagcccagccttccgctatgacctgctggatgtc
acccgccaagccgtgcaggagttggtcagcctgtgctatgaggaggcaaggaccgcctac
ctgaagcaagagcttgatctcctgctcagggctggaggcctcctggtctataaactcctg
cctacactagatgagctgctggctagcagcagccacttcttgctgggtacctggttggat
caggcccggaaagcggccgtaagtgaggccgaggcccagttctatgaacaaaacagccgc
taccagattaccctgtgggggcccgagggcaacattttggattatgccaataagcaactg
gcaggactggtggctgattactaccagcctcgctggtgcctcttcttggggactctggct
cacagcctagccagaggtgtccccttccaacagcacgagtttgagaagaacgttttccca
ctcgagcaggctttcgtttacaacaagaagaggtaccccagtcagccccgaggggacacc
gtggacctctccaagaagatcttcctcaaatatcacccccagcctgactctttgtga

DBGET integrated database retrieval system