KEGG   Mus musculus (mouse): 27421Help
Entry
27421             CDS       T01002                                 

Gene name
Abcc6, Abcc1b, DCC, Dyscalc1, Mrp6, dyscalc
Definition
(RefSeq) ATP-binding cassette, sub-family C (CFTR/MRP), member 6
  KO
K05669  ATP-binding cassette, subfamily C (CFTR/MRP), member 6
Organism
mmu  Mus musculus (mouse)
Pathway
mmu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    27421 (Abcc6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    27421 (Abcc6)
Transporters [BR:mmu02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC1, 2, 3, 4, 5, 6, 10, 11, 12, 13 subgroups
    27421 (Abcc6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ABC_membrane ABC_tran SMC_N MMR_HSR1 AAA_16 AAA_22 AAA_21 RsgA_GTPase AAA_25 AAA_29 Dynamin_N T2SSE
Motif
Other DBs
NCBI-GeneID: 27421
NCBI-ProteinID: NP_061265
MGI: 1351634
Ensembl: ENSMUSG00000030834
Vega: OTTMUSG00000031288
UniProt: Q9R1S7
Position
7 29.64 cM; 7 B3
AA seq 1498 aa AA seqDB search
MNRGRSMATPGEQCAGLRVWNQTEQEPAAYHLLSLCFVRAASSWVPPMYLWVLGPIYLLY
IHRHGRCYLRMSHLFKTKMVLGLALILLYTFNVAVPLWRIHQGVPQAPELLIHPTVWLTT
MSFATFLIHMERRKGVRSSGVLFGYWLLCCILPGINTVQQASAGNFRQEPLHHLATYLCL
SLVVAELVLSCLVDQPPFFSEDSQPLNPCPEAEASFPSKAMFWWASGLLWRGYKKLLGPK
DLWSLGRENSSEELVSQLEREWRRSCNGLPGHKGHSSVGAPETEAFLQPERSQRGPLLRA
IWRVFRSTFLLGTLSLVISDAFRFAVPKLLSLFLEFMGDRNSSAWTGWLLAVLMFAAACL
QTLFEQQHMYRAKVLQMRLRTAITGLVYRKVLVLSSGSRKSSAAGDVVNLVSVDIQRLAE
SIIYLNGLWLLFLWIFVCFVYLWQLLGPSALTAVAVFLSLLPLNFFITKKRGFHQEEQMR
QKASRARLTSSMLRTVRTIKSHGWEHAFLERLLHIRGQELSALKTSTLLFSVSLVSFQVS
TFLVALVVFAVHTLVAEDNAMDAEKAFVTLTVLSILNKAQAFLPFSVHCIVQARVSFDRL
AAFLCLEEVDPNGMIASNSRRSSKDRISVHNGTFAWSQESPPCLHGINLTVPQGCLLAVV
GPVGAGKSSLLSALLGELLKVEGSVSIEGSVAYVPQEAWVQNTSVVENVCFRQELDLPWL
QKVLDACALGSDVASFPAGVHTPIGEQGMNLSGGQKQRLSLARAVYKKAAIYLLDDPLAA
LDAHVSQQVFKQVIGPSGLLQGTTRILVTHTLHVLPQADRILVLANGTIAEMGSYQDLLQ
RNGALVGLLDGARQPAGTHDAATSDDLGGFPGGGRPTCRPDRPRPTEAAPVKGRSTSEVQ
MEASLDDPEATGLTAEEDSVRYGRVKTTIYLSYLRAVGTPLCTYTLFLFLCQQVASFSQG
YWLSLWADDPVVDGRQMHAALRGWVFGLLGCLQAIGLFASMAAVFLGGARASGLLFRSLL
WDVARSPIGFFERTPVGNLLNRFSKETDTVDVDIPDKLRSLLTYAFGLLEVGLAVTMATP
LAIVAILPLMVLYAGFQSLYVATSCQLRRLESARYSSVCSHMAETFQGSLVVRAFRAQAS
FTAQHDALMDENQRVSFPKLVADRWLATNLELLGNGLVFVAATCAVLSKAHLSAGLVGFS
VSAALQVTQTLQWVVRSWTDLENSMVAVERVQDYARIPKEAPWRLPTCAAQPLWPCGGQI
EFRDFGLRHRPELPLAVQGVSLKIHAGEKVGIVGRTGAGKSSLAWGLLRLQEAAEGNIWI
DGVPITHVGLHTLRSRITIIPQDPVLFPGSLRMNLDLLQEHTDEGIWAALETVQLKAFVT
SLPGQLQYECAGQGDDLSVGQKQLLCLARALLRKTQILILDEATASVDPGTEMQMQAALE
RWFTQCTVLLIAHRLRSVMDCARVLVMDEGQVAESGSPAQLLAQKGLFYRLAHESGLA
NT seq 4497 nt NT seq  +upstreamnt  +downstreamnt
atgaacagagggcgctccatggccacgcctggagagcagtgcgccggcctgagggtctgg
aaccagacagagcaggagcctgcggcctatcacttgctcagcctgtgctttgtgagagcc
gccagcagctgggtgccccccatgtacctctgggtcctcggccccatctaccttctctac
atccatcgccatggccggtgctacctccggatgtcccacctcttcaaaaccaaaatggtg
ctgggcttggccctcatccttctgtataccttcaacgtggccgtgcctctgtggaggatc
caccagggcgtgccccaggccccagagcttctaattcaccctactgtgtggctcaccacc
atgagctttgccacctttctgatccacatggagagaaggaagggagtccggtcatccggg
gtgttgttcgggtactggctgctctgctgcatcttgccaggaatcaacactgtgcagcag
gcctctgcagggaacttccgtcaggagcccctccaccacctggccacctacctgtgcttg
tccctggtggtggctgagctggtgctgtcctgtctggtggaccagccacccttcttctcg
gaagactcccagccattgaatccgtgtccagaggctgaggcctcctttccctccaaggcc
atgttctggtgggcctctggactgctatggaggggctacaaaaagctgctgggaccaaaa
gacctctggtcacttgggagagaaaactcttcagaagaactcgtttcccagctggaaaga
gaatggaggagaagctgcaatgggctgccagggcacaaagggcacagtagtgtgggggcc
cctgagacagaggccttcctgcagccagagaggagtcagaggggcccactactcagggct
atctggcgcgtgttccggtccaccttcctgctggggaccctcagcctggtcattagcgat
gccttcaggtttgctgttcccaagctcctcagtctgtttctggagttcatgggtgaccgc
aactcctcggcgtggacaggctggctcctagctgtgctgatgttcgcggcagcctgccta
cagacgttgtttgaacagcagcacatgtacagagccaaggtcctgcagatgaggctgcga
acagccatcactggcctggtgtacagaaaggtcctggtcctgtccagtggttccagaaag
tccagcgcagcaggggacgtggtcaacctggtgtcggtggacatccagcggctggccgag
agcatcatctacctcaacgggctgtggctgctcttcctgtggatctttgtgtgctttgtc
tacctgtggcagctccttggaccctctgctctcacagccgttgctgtcttcctgagcctc
ctccctctgaacttcttcatcaccaagaagaggggcttccatcaggaagaacagatgagg
cagaaggcctccagagcacggctcaccagctccatgctcagaactgtgagaaccatcaag
tcccacggctgggagcatgccttcctggagcgactccttcacatccggggccaggagctc
agcgccctgaagacctccaccctcctcttctctgtgtctctcgtgtccttccaagtgtct
acatttctggtggcgctggtcgtgtttgctgtccacaccctggtggcagaggacaatgcc
atggatgcagagaaggcctttgtgacgctcacagtgctcagcatccttaacaaagcccag
gccttcctccccttctctgtgcactgcatcgttcaggctcgagtgtcctttgaccggctg
gctgccttcctgtgcctggaagaagtagaccccaatggcatgatcgcgagtaactccagg
cgctcctcgaaggatcgaatttctgtacacaatggcaccttcgcttggtcccaggagagc
ccaccctgcctgcacgggatcaacctcaccgtgccccagggctgtctgctggctgttgtg
ggtccagtgggggctgggaagtcctccctgctgtctgccctgcttggggagctgttgaag
gtagaagggtctgtgagcattgagggttccgtggcttacgtgcctcaggaggcctgggtc
cagaatacctctgtggtggagaatgtgtgcttcaggcaagagctggacctgccctggttg
cagaaagttctagatgcctgtgccttggggtctgatgtggccagcttccctgcaggagtt
cacaccccaataggggagcagggcatgaatctttctgggggccagaagcagcggctgagc
ttggctcgggctgtgtacaaaaaggctgccatctacttgctggatgaccccctggcagcg
ctggatgcccacgtcagccagcaggtcttcaaacaggtcatcgggcccagtggattgctc
cagggtacgactcggatccttgtaacacacacgctgcacgtcctgccccaggctgaccgg
atcctggtgctggccaatgggaccatcgcagagatgggctcctaccaggaccttctgcaa
aggaacggagccctggtgggtcttctggatggagccagacagcctgcaggaacacacgat
gcagctaccagtgacgacctcggaggctttcctggaggtgggaggcccacatgcagacca
gacaggcccaggcccacggaggcagcccctgtgaagggcaggagcacatctgaggtacag
atggaggcttctctggatgaccctgaggccacaggattgacagcagaagaggatagtgtg
cgatatggccgggtgaagaccaccatatacctgagctacctgcgggcggtgggcacaccc
ctctgtacctacaccctgttcctcttcctctgccagcaagtggcatccttctcccaaggc
tactggctgagcctttgggccgatgacccggttgtggatgggcggcagatgcatgcagcc
ctgcgtggctgggtctttgggctccttggctgtctgcaagccatcggactgtttgcctcc
atggctgcggtgttcctgggtggagcccgggcctcaggcctccttttccggagtctcctg
tgggacgtggctcgctctcccatcggcttctttgagcgcacgccagtcgggaacctgctg
aaccgcttttccaaggagacagacacagtggatgtggacatcccggacaagctgaggtcc
cttctgacctacgcctttgggctcctggaggtcggcctggcagtgacgatggccacgcct
ctggccattgtggccatcctacctctcatggtcctctatgctgggtttcagagcctctat
gtggccacatcttgccagctgagacgtctagagtcggcccgctactcatctgtgtgttcc
catatggctgagaccttccagggaagtctggtggtcagggccttccgggcccaggcatcc
ttcacggctcagcacgatgctctcatggatgagaaccagagggtcagtttcccgaaactg
gtggctgacaggtggctggctactaacctggagcttctagggaatggcttggtattcgtg
gctgctacatgtgctgtgctgagcaaggctcacctaagtgctggcctcgtgggcttctcg
gtctccgctgccctccaggtgacacagactctgcagtgggtggtccgcagctggacagat
ctggagaacagcatggtagccgtggagcgcgtgcaggactacgctcgcatccccaaagag
gctccctggaggctgcccacctgcgcagcccagcctctctggccttgtgggggacagatt
gagttccgggactttgggctcagacaccgaccagagctgcccttggctgtgcagggagtg
tccctgaagatccatgcaggagagaaggtgggcatcgtgggcagaacaggggccgggaag
tcctccctggcttggggcctgctgcggcttcaggaggctgccgagggtaatatctggatc
gatggggtccctatcacccatgtggggctgcacacactgaggtcccgaatcaccatcatc
cctcaggaccctgtcctgttcccaggctctctgcggatgaacctggacctgcttcaggag
cacacagatgaaggcatctgggcagcgctggagacagtgcagctcaaggccttcgtgacc
agcctgcctggccagctgcaatatgagtgtgcaggccagggagatgacctgagcgtgggt
cagaaacagctcctgtgcctggcacgagcccttctccggaaaacccagatcctcatcctg
gacgaggcgactgcctctgtggacccagggacggagatgcagatgcaggcggccctggag
cgctggtttacacagtgtaccgtactgcttatcgctcaccgcctgcgctccgtgatggac
tgtgccagagtcctagtcatggatgaggggcaggtggcagaaagtggcagtcctgctcag
ctgctggcccagaaaggcctgttttacaggctagcccatgagtcgggcctcgcttga

DBGET integrated database retrieval system