KEGG   Mus musculus (mouse): 27426Help
Entry
27426             CDS       T01002                                 

Gene name
Nagpa, AI596180, UCE
Definition
(RefSeq) N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase
  KO
K01125  N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase [EC:3.1.4.45]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04142  Lysosome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    27426 (Nagpa)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.45  N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase
     27426 (Nagpa)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAGPA EGF_2
Motif
Other DBs
NCBI-GeneID: 27426
NCBI-ProteinID: NP_038824
MGI: 1351598
Ensembl: ENSMUSG00000023143
Vega: OTTMUSG00000028133
UniProt: Q8BJ48
Position
16; 16 A1
AA seq 517 aa AA seqDB search
MAAPRGPGLFLIPALLGLLGVAWCSLSFGVSRDDDLLLPYPLARRRPSRDCARVRSGSPE
QESWPPPPTNPGASHHAAVRTFVSHFEGRAVAGHLTRVADPLRTFSVLEPGGAGGCAQKR
RATVEDTAVPAGCRIAQNGGFFRMSTGECLGNVVSDGRLVSSSGGLQNAQFGIRRDGTIV
TGYLSEEEVLDPVNPFVQLLSGVVWLIRNGNIYINESQAIECDETQETGSFSKFVNVMSA
RTAVGHDREGQLILFHADGQTEQRGLNLWEMAEFLRQQDVVNAINLDGGGSATFVLNGTL
ASYPSDHCQDNMWRCPRQVSTVVCVHEPRCQPPDCSGHGTCVDGHCECTSHFWRGEACSE
LDCGPSNCSQHGLCTETGCHCDAGWTGSNCSEECPLGWYGPGCQRPCQCEHQCSCDPQTG
NCSISQVRQCLQPTEATPRAGELASFTRTTWLALTLTLIFLLLISTGVNVSLFLGSRAER
NRHLDGDYVYHPLQEVNGEALTAEKEHMEETSNPFKD
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgcccagggggcccgggctgttcctcatacccgcgctgctcggcttactcggg
gtggcgtggtgcagcctaagcttcggggtttcccgcgacgatgacctgctgctgccttac
ccactagcgcgcagacgtccctcgcgagactgcgcccgggtgcgctcaggtagcccagag
caggagagctggcctccgccacccacgaaccccggcgccagccaccacgcggccgtgcgc
accttcgtgtcgcacttcgaggggcgcgcggtggccggccacctgacgcgggtcgccgat
cccctacgcactttctcggtgctggagcccggaggagccgggggctgcgcgcagaagcgc
cgcgctactgtggaggacacagccgtcccggccggttgccgcatcgctcagaacggtggc
ttcttccgcatgagcactggcgagtgcttggggaacgtggtgagcgacgggcggctggtg
agcagctcagggggactgcagaacgcgcagttcggtatccgacgcgatggaaccatagtc
accgggtacctgtctgaggaggaggttctggatcccgtgaatccgttcgtgcagctgctg
agcggagtcgtgtggctcatccgcaatggaaacatctacatcaacgagagccaagccatc
gagtgtgacgagacacaggagacaggttcttttagcaaatttgtgaatgtgatgtcagcc
aggacagccgtgggtcatgaccgtgaggggcagcttatcctcttccatgctgatggacag
acggaacagcgtggccttaacctatgggagatggcagagttcctgcgtcaacaagatgtc
gtcaatgccatcaacctggatggaggcggttctgctacttttgtgctcaatgggaccctg
gccagttacccttcagatcactgccaggacaacatgtggcgctgtccccgccaagtgtcc
actgtggtgtgtgtgcatgaaccgcgctgccagccacccgactgcagtggccatgggacc
tgtgtggatggccactgtgaatgcaccagccacttctggcggggcgaggcctgcagcgag
ctggactgtggcccctccaactgcagccagcatgggctgtgcacagagactggctgccac
tgtgatgctgggtggacaggatccaactgcagtgaagagtgtcctctgggctggtatggg
ccaggttgccagaggccctgccagtgtgagcaccagtgttcctgtgacccgcagactggc
aactgcagcatctcccaagtgaggcagtgtctccagccaactgaggctacgccgagggca
ggagagctggcctctttcaccaggaccacctggctagccctcaccctgacactaattttc
ctgctgctgatcagcactggggtcaacgtgtccttgttcctgggctccagggccgagagg
aaccggcacctcgacggggactatgtgtatcacccactgcaggaggtgaacggggaagcg
ctgactgcagagaaggagcacatggaggaaactagcaaccccttcaaggactga

DBGET integrated database retrieval system