KEGG   Mus musculus (mouse): 27428
Entry
27428             CDS       T01002                                 

Gene name
Shroom3, AL022960, D5Ertd287, D5Ertd287e, Sh, Shr, Shrm, Shrm3
Definition
(RefSeq) shroom family member 3
  KO
K18625  protein Shroom
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    27428 (Shroom3)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     27428 (Shroom3)
SSDB
Motif
Pfam: ASD2 ASD1 PDZ PDZ_6
Other DBs
NCBI-GeneID: 27428
NCBI-ProteinID: NP_056571
MGI: 1351655
Ensembl: ENSMUSG00000029381
Vega: OTTMUSG00000036945
UniProt: Q9QXN0 E9QMY5
Position
5 E2; 5 47.29 cM
AA seq 1980 aa
MKTPENLEEPSATPNPSRTPTERFVYLEALLEGGAPWGFTLKGGLERGEPLIISKIEEGG
KADSVSSGLQAGDEVIHINEVALSSSRREAVSLVKGSYKTLRLVVRRDVCAAPGHADPGT
SKSLSSELLTCSPQHRKATWSGGVKLRLKQRCSEPATRPHSWHTTKFGETQPDVSMMQIS
QGTMGPPWHQSYHSSSSTSDLSNYDHAYLRRSPDQCSSQGSMESLEPSGGYPPCHLLSPA
KSTSSIDQLGHLHNKRDSAYSSFSTSSSIFEYPPPGGSARERSGSMDVISARGGLLEGMR
QADIRYVKTVYDTRRGVSSEYEVNPSALLLQGRDAHASADSQGCAKWHSIPRGKGTPSPS
WSQQCSGSLETATDNLPQKAGAPLPPTRSDSYAAFRHRERPSSWSSLDQKRFCRPQTNSS
GSQKTPFAEDQLHTVPERSPENSPPVKSKHNYTQKAQPGQPLLPTGIYPVPSPEPHFAQV
PQPSVSSNGTVYPALVKESGYTAAQGTCNKMATLDENGNQNEASRPGFAFCQPLEHNSVT
PVEKRPEPTAKYIYKVHFSSVPENEDSSLKRHITPPHGHSPYPSERKNIHGGSRACSNHH
SLSSPQAQALHVGDDRRPSRLSQPWEGDFQEDHNANLRQKVEREGQGQGLSGNSGRTRSA
FSSLQNIPESLRRQSNVELGEAQEVHPGGRSKVEDPGRKAGASDIRGYLDRSVSYPRPEG
KMNAVDSVHSADSRYEESPAPALPQTSGASQRRLSSSSSAAPQYRKPHCSVLEKVSRIEE
REQGRHRPLSVGSSAYGPGYRPGRTGPTPSTSSSDLDDPKAGSVHFSESTEHLRNGEQNP
PNGEAKQEEASRPQCSHLIRRAPADGRGPPARGGEPSRPEARLLRSQSTFQLYSEAEREA
SWSEDRPGTPESPLLDAPFSRAYRNSIKDAQSRVLGATSFRRRDLEPGTPATSRPWRPRP
ASAHVGMRSPEAAVPSSSPHTPRERHSVTPAAPQAARRGPRRRLTVEQKKRSYSEPEKMN
EVGVSEEAEPTPCGPPRPAQPRFSESTVADRRRIFERDGKACSTLSLSGPELKQFQQSAL
ADYIQRKTGKRPTGAACTPEAGLRERAQSAYLQAGPAAPDGPGLASACSLSSLREPEALP
RKEHTHPSAADGPQAPRDRSSSFASGRLVGERRRWDPQVPRQLLSGANCEPRGVQRMDGA
PGGPPSWGMVAGKAGKSKSAEDLLERSDTLAVPVHVRSRSSPTSDKKGQDVLLREGSNFG
FVKDPCCLAGPGPRSLSCSDKGQNELALPLHHPTPCWNGSGCKATVASSAPPESSGAADH
LKQRRAPGPRPLSAGMHGHFPDARAASLSSPLPSPVPSSYRSQLAMDQQTGQQPPSSPAS
AVTQPTSPRSPELSSPAYGLGEGMWKRTSLPQRPPPPWVKWAHAVREDGLAEDTLAPEFA
NLKHYRNQPSRPSSCSTSDPDTPGRISLRISESALQPSPPPRGDYDDEVFMKDLHPKVTS
SPTFEALPPPPPPSPPSEEPLVNGTDDFPPPPPPQALCEVLLDGEASTEAGSGPCRIPRV
MVTREGHVPGAAHSEGSQIMTATPPQTSAKGSEAESNTPSSASAQPQLNGSPGKQLCPSQ
TRNLTYEPVERTQDLGKKTHAEPQKTSEDIRTEALAKEIVHQDKSLADILDPDSRMKTTM
DLMEGLFPGDASVLMDSGAKRKALDITARRAGCEAKASDHKEAVSVLVNCPAYYSVSAAK
AELLNKIKDMPEELQEEEGQEDVNEKKAELIGSLTHKLESLQEAKGSLLTDIKLNNALGE
EVEALISELCKPNEFDKYKMFIGDLDKVVNLLLSLSGRLARVENVLRGLGEDASKEERSS
LNEKRKVLAGQHEDARELKENLDRRERVVLDILANYLSAEQLQDYQHFVKMKSTLLIEQR
KLDDKIKLGQEQVRCLLESLPSDFRPKAGAISLPPALTGHGTPGGTSVFGGVFPTLTSPL
NT seq 5943 nt   +upstreamnt  +downstreamnt
atgaagactccggagaacttggaggagcctagcgccacgccaaaccccagtaggaccccc
acggagagattcgtttatctggaagcgctcctagagggaggggctccctggggcttcacc
ctgaaaggtggcctggagcgtggagaaccgttaatcatttccaagattgaagaagggggc
aaagccgactcagtgagctccggactgcaagctggggacgaagtcatacacatcaatgag
gtggcgctgagcagttccaggagagaggctgtctccctagtgaaagggtcctacaagacc
ctgcggctggtggtgcgcagagacgtgtgtgcggccccgggccatgctgatcctggtacc
tctaagtccctcagctcagagctgctcacctgcagtccccagcaccggaaagcaacatgg
tcaggaggggtgaagcttcggctaaagcagaggtgcagtgagcctgccactcgccctcac
tcgtggcataccaccaaatttggggagacacagcctgatgtcagcatgatgcagatatct
cagggcacaatgggccctccttggcaccagagctaccattccagctcttcgaccagtgac
ctctccaactacgaccatgcttatctgaggcggagccctgaccagtgcagctcccagggg
agcatggaaagcctggagcccagtggcggatacccaccctgccatctcctttctcctgcc
aagtccacgagcagcatcgaccagctaggccaccttcataacaaaagggactccgcatat
agctccttctccaccagttcgagcatcttcgagtacccaccccctggtggctctgcccga
gaacgttcgggttccatggacgtgatttctgcccggggtggcctcctagaagggatgagg
caggcagacatccgctacgtcaagacggtctatgatacccggagaggagtatcttcagag
tatgaggtgaacccttcagccttgctccttcaaggtagggatgcccatgcctcagccgac
agtcagggctgtgctaaatggcacagcattcctcggggcaagggaacgccttccccgtct
tggagccagcagtgttctggttccctggagactgctactgacaacctgccccagaaggca
ggcgcacccctgccccccacccgcagtgatagctatgcagccttccgccatcgcgagcgt
cccagctcctggtccagccttgatcagaaaaggttctgccggcctcagacaaactcttca
ggctcccagaaaaccccattcgctgaggaccagctgcatacagtcccagagaggagtcca
gagaacagccccccagtgaaatctaagcataattatacccagaaggcgcagcctggccaa
cctctgctgcccactggcatctatccggtaccttctccggagcctcactttgcccaggtg
ccccagccctctgtgagtagtaatggcaccgtctaccctgcgctagtcaaagagagtgga
tacacagctgctcagggaacctgtaacaagatggctaccttagatgagaacgggaatcaa
aatgaagctagcaggcctgggtttgccttctgtcagcccctagaacacaactcggtgact
ccggtggagaaaaggccagaacccacggccaaatacatctacaaagtccatttttcttca
gtgcctgaaaatgaagactcctccctaaagaggcacatcacacctccccacggccatagt
ccatatcccagcgagagaaagaacatccacggtggcagcagagcgtgttccaatcaccac
agtctctcgtccccccaggcccaggccctgcacgtgggtgatgacaggaggccttccagg
ctctctcagccctgggagggtgactttcaggaagatcacaatgccaacctcaggcagaaa
gtggagagggagggccaaggccagggcctgtcgggcaactctggcaggaccagatcggcc
ttctcatctctgcagaatattccagagagtctgagaagacaaagcaacgtggagcttgga
gaagcccaggaggttcaccccgggggcaggtccaaggtggaggaccctggaaggaaagca
ggggcttcagacatcaggggctacctggacagatctgtttcctatccgaggcccgagggg
aaaatgaacgccgtagactccgtccacagtgcagactccaggtatgaggagtccccggcc
ccagcgctgccacagacatccggtgcgagccagcggcggctcagctccagcagctccgcc
gccccgcagtacaggaagccccattgctccgtgctggagaaggtttctagaatagaggaa
cgagagcaggggcgccacagacccctgagcgtgggcagctctgcatacggccccggctac
aggcctgggaggaccggcccgacccccagtacttccagcagtgacctcgacgatccaaaa
gccggcagcgtccatttctcggagtccactgaacacctgcgcaatggggagcagaacccc
ccaaacggggaggctaagcaggaagaggcttcccggccccagtgcagccatttgatccgg
agggcccctgcggacggccgtggacctcctgcccgaggcggcgagccctcaaggccggag
gcccgcctgctccgcagccagagcacctttcagctctacagtgaggcggagagggaagcc
tcgtggtcagaggacaggcccggtacccctgagtcgcccctgctcgatgcgcctttcagc
cgcgcctacagaaacagcatcaaggatgcccagtcccgcgtcctgggggccacgtcgttt
cgtcgccgagacctggaaccgggcacccccgccacctcgaggccctggcgcccgcgaccc
gcctccgcccacgtggggatgcggagccccgaggccgcggtgccctcgtcctccccgcac
acccctcgggagcgacacagcgtgaccccggccgcgccccaggctgcccgccgaggccca
cgccggcgcctcactgtcgagcagaagaagcgctcctactcggagcccgagaagatgaac
gaggtaggggtctcggaggaggccgagcccacgccctgcggcccgccgaggcccgcgcag
ccgcgcttctcggagagcaccgtggccgaccggcgccgcatcttcgagcgcgacggcaag
gcctgctccacgctcagcctgtcgggccccgagctcaagcagttccagcagagcgccctg
gccgactacatccagcgtaagacgggcaagcggcccacaggagccgcctgcacaccggag
gccgggctgcgcgagcgcgcacagagcgcctacctccaggccggccccgcggcgcccgat
ggccccggcctggcctctgcctgtagcctgagctccctgcgagagcccgaggcgctgccc
cgcaaggagcacactcatccgtcggccgcggacggcccgcaggcgccccgtgatcgcagc
agctccttcgccagcggacgcctagtcggggagcgacgtcgctgggaccctcaggtcccc
aggcagctgctcagcggagcgaactgcgaaccgaggggcgtccagaggatggacggggcc
ccgggcgggccgccttcctggggcatggtggccgggaaggccgggaagtccaagtcagcc
gaggatctgctggagcgctccgacacactggcggtccctgtgcatgtgaggtccaggtcg
tctcccacctccgacaagaaaggtcaggatgtgctcctgagggaaggcagcaactttggt
tttgtaaaggatccatgctgtttggctggccctggacctaggtctctcagctgctcagac
aaaggccagaatgagctggcattgcccctgcaccaccctacgccctgctggaacggctca
ggctgcaaagccactgtggcttcctcagctcctcccgaatcttctggagccgcggatcat
ctgaagcaacgtagagcgcctggtcctaggccactctcagcaggaatgcacggccacttc
ccagacgccagagctgcctcactcagctcccctctgccatcacctgtcccctccagttac
cggtcacagcttgccatggatcagcagactgggcaacagcctccctcatcccctgcctct
gcagtgacccagcctaccagtccaagaagccctgagctcagcagcccagcatatgggcta
ggggaggggatgtggaagaggacatccctgcctcagcgaccccctcccccttgggtgaaa
tgggcccacgcggtcagagaggacggccttgctgaggacaccttggcgcctgagtttgcg
aacctgaagcactatagaaaccagccgagtcgtccgagttcctgcagcacttctgaccca
gacactccaggaaggatctcgctccgaatatcggagtcagcccttcaaccttccccaccg
ccccggggggactatgatgacgaagtgttcatgaaggacttgcaccccaaggttacttca
agccccacatttgaagctcttcccccacccccgccaccttcgccaccgagcgaggaacct
ctagtgaatggcacagatgactttcctccgcctcctcctccccaagccctgtgtgaggta
ctgctggatggtgaggcatccacggaagctggcagcggcccctgcagaattcccagggtg
atggtcacaagggaagggcacgtgcctggggcagcccattccgaaggtagtcagataatg
actgccacaccaccccaaacctcggccaaaggttcagaagccgagtccaacacgccttcc
agcgcgagcgcccagcctcagctcaacggttctcctggcaagcagctctgtcccagccag
acccgaaacctcacttatgaacctgtcgagagaactcaggatctaggaaagaaaactcac
gccgagcctcagaagacctcagaagatatccggacagaggctctagccaaggaaattgtc
caccaagacaagtctctggcagacattttagatcctgactccaggatgaagacaacgatg
gacctgatggagggtttattccctggagacgccagtgtgctgatggatagtggcgcaaag
aggaaagccttagacatcaccgccaggcgtgcgggatgtgaagccaaggcgagcgaccac
aaggaggcagtgagtgtgctggtcaactgtcctgcctactacagtgtctctgctgccaag
gcggagctgctcaacaaaatcaaagacatgccggaggagctgcaggaggaggaggggcag
gaggatgtcaatgagaaaaaggctgagcttatcggaagccttacccacaagctggagagc
ctccaggaagccaaggggagcctgctcacggacatcaagctgaacaatgccctgggagag
gaggtggaggctctgatcagtgagctctgcaaacccaacgagtttgacaagtacaagatg
ttcataggggacctggacaaggtggtcaacctgctgctgtccctgtctggacgcctggcc
cgcgtggagaacgtcctcagaggccttggtgaagacgccagcaaagaggaaaggagttct
ctgaacgagaaaaggaaggttctggctggccagcatgaggatgcacgggagctcaaggag
aacctggaccggagggagcgcgtggtgctggatatcctggccaactacctgtccgccgag
cagctgcaggactaccagcacttcgtgaagatgaagtccacactcctcattgagcagcgg
aagctggatgacaagataaagctgggccaggagcaggtcaggtgcctgctggagtcgctt
ccctcggacttcaggcccaaggcaggggccatctccctccctccagccctcaccggccat
gggactcctggggggacatctgtattcggtggtgttttcccaacgttgacctctcctctt
taa

DBGET integrated database retrieval system