KEGG   Mus musculus (mouse): 27528Help
Entry
27528             CDS       T01002                                 

Gene name
Nrep, AI325076, D0H4S114, Harp, P311, PTZ17, SEZ17
Definition
(RefSeq) neuronal regeneration related protein
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: Alveol-reg_P311
Motif
Other DBs
NCBI-GeneID: 27528
NCBI-ProteinID: NP_001103458
MGI: 99444
Ensembl: ENSMUSG00000042834
UniProt: Q07475 Q542Q5
Position
18; 18 B1
AA seq 68 aa AA seqDB search
MVYYPELLVWVSQEPFAYKEMEGGLIKGRLPVPKEVNRKKMEETGAASLTPPGSREFTSP
ATSYLHPF
NT seq 207 nt NT seq  +upstreamnt  +downstreamnt
atggtttactacccagaactcttggtctgggtcagccaagaaccgtttgcatacaaggaa
atggagggaggtcttattaagggaagacttcccgtgcctaaggaagtgaaccgaaagaag
atggaggagactggcgctgcctcgctgactccgccaggcagccgtgaattcacctctcca
gctaccagttacctccaccctttttaa

DBGET integrated database retrieval system