KEGG   Mus musculus (mouse): 27528
Entry
27528             CDS       T01002                                 

Symbol
Nrep, AI325076, D0H4S11, D0H4S114, Harp, P31, P311, PTZ1, PTZ17, SEZ17, Sez1
Name
(RefSeq) neuronal regeneration related protein
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: Alveol-reg_P311
Other DBs
NCBI-GeneID: 27528
NCBI-ProteinID: NP_001103458
MGI: 99444
Ensembl: ENSMUSG00000042834
UniProt: Q07475 Q542Q5
Position
18; 18 B1
AA seq 68 aa
MVYYPELLVWVSQEPFAYKEMEGGLIKGRLPVPKEVNRKKMEETGAASLTPPGSREFTSP
ATSYLHPF
NT seq 207 nt   +upstreamnt  +downstreamnt
atggtttactacccagaactcttggtctgggtcagccaagaaccgtttgcatacaaggaa
atggagggaggtcttattaagggaagacttcccgtgcctaaggaagtgaaccgaaagaag
atggaggagactggcgctgcctcgctgactccgccaggcagccgtgaattcacctctcca
gctaccagttacctccaccctttttaa

DBGET integrated database retrieval system