KEGG   Mus musculus (mouse): 27632Help
Entry
27632             CDS       T01002                                 

Gene name
Nelfe, D17H6S45, NELF-E, RD, Rdbp
Definition
(RefSeq) negative elongation factor complex member E, Rdbp
  KO
K15182  negative elongation factor E
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mmu03021]
    27632 (Nelfe)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    NELF complex
     27632 (Nelfe)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 Nup35_RRM_2 RRM_occluded
Motif
Other DBs
NCBI-GeneID: 27632
NCBI-ProteinID: NP_001039328
MGI: 102744
Ensembl: ENSMUSG00000024369
Vega: OTTMUSG00000037262
UniProt: P19426 Q3UIA1
Position
17 B1; 17 18.4 cM
AA seq 367 aa AA seqDB search
MLVIPPGLSEEEEALQKKFNKLKKKKKALLALKKQSSSGPASQGGVKRSLSEQPVVDTAT
ATEQAKQLVKSGAISAIKAETKNSGFKRSRTLEGKLKDPEKGPVPTFQPFQRSMSADEDL
QEPSRRPQRKSLYESFVSSSDRLRELGQDGEEAEAPGAGDGPPRGFDWSYEEHGSARSSA
SPPRSRSRDRSHDRSRDRDRDKERDRDRDRDRDRDRDKDKDRDRDRDRDRDRDRERDREG
PFRRSDSFPERRAPRKGNTLYVYGEDMTPTLLRGAFSPFGNIIDLSMDPPRNCAFVTYEK
MESADQAVAELNGTQVESVQLKVNIARKQPMLDAATGKSVWGSLAVQNSPKGCHRDKRTQ
IVYSDDL
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgttggtgatacctccggggctgagtgaagaggaagaggcactgcagaagaagttcaac
aaactcaagaagaagaaaaaggcattgctggctctgaagaagcagagcagcagcggccca
gcgagccagggcggtgtcaaacgctcactgtcagagcagcctgtggtggacactgccaca
gcaacagaacaggccaaacaactggtgaagtcaggagccatcagtgccatcaaggctgaa
actaagaactcaggcttcaaacgttctcggaccctggaagggaagttaaaggacccagag
aaggggcctgtccccactttccagccgttccagaggagcatgtctgctgatgaggaccta
caggagccatccagacgtccccagaggaaatctctgtatgaaagctttgtgtcttctagt
gatcggcttcgggaactgggacaagatggagaagaagcagaggcccccggggctggtgat
ggcccacctcgaggctttgactggagctatgaagagcatggtagcgcccgctcctcagcc
tcccctccccgaagccgcagcagggaccgaagtcatgaccggagccgagatagggatcgg
gacaaagagagagacagagaccgagatcgagatcgagacagagaccgggataaagacaaa
gacagagaccgggatcgagacagagaccgggaccgagatcgggaacgagaccgagagggc
cctttccgcaggtcagactcattccccgaacggagggcccctcgaaaggggaacacactg
tatgtgtatggagaggacatgacgcccaccctcctccgcggggccttctctccctttgga
aatatcatcgacctctccatggacccacccagaaactgtgccttcgtcacctacgagaag
atggagtctgcagatcaggctgttgctgagctcaatgggacccaggtggaatctgtgcag
cttaaagtcaacatagcccgaaaacagcccatgctggacgctgctactggcaaatctgtc
tggggctcccttgctgtccagaacagccctaagggttgccatcgagacaagaggacccag
attgtgtacagtgacgatctatag

DBGET integrated database retrieval system