KEGG   Mus musculus (mouse): 277328
Entry
277328            CDS       T01002                                 

Symbol
Trpa1, ANKT, Anktm1, TRPA1b
Name
(RefSeq) transient receptor potential cation channel, subfamily A, member 1
  KO
K04984  transient receptor potential cation channel subfamily A member 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    277328 (Trpa1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    277328 (Trpa1)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  Transient receptor potential channel (TRP)
   277328 (Trpa1)
SSDB
Motif
Pfam: Ank_2 Ank_4 Ank Ank_3 Ank_5 Ion_trans SchA_CurD
Other DBs
NCBI-GeneID: 277328
NCBI-ProteinID: NP_808449
MGI: 3522699
Ensembl: ENSMUSG00000032769
Vega: OTTMUSG00000049207
UniProt: Q8BLA8
Position
1; 1 A3
AA seq 1125 aa
MKRGLRRILLPEERKEVQGVVYRGVGEDMDCSKESFKVDIEGDMCRLEDFIKNRRKLSKY
EDENLCPLHHAAAEGQVELMELIINGSSCEVLNIMDGYGNTPLHCAAEKNQVESVKFLLS
QGANPNLRNRNMMSPLHIAVHGMYNEVIKVLTEHKATNINLEGENGNTALMSTCAKDNSE
ALQILLEKGAKLCKSNKWGDYPVHQAAFSGAKKCMELILAYGEKNGYSRETHINFVNHKK
ASPLHLAVQSGDLDMIKMCLDNGAHIDMMENAKCMALHFAATQGATDIVKLMISSYTGSS
DIVNAVDGNQETLLHRASLFDHHDLAEYLISVGADINSTDSEGRSPLILATASASWNIVN
LLLCKGAKVDIKDHLGRNFLHLTVQQPYGLRNLRPEFMQMQHIKELVMDEDNDGCTPLHY
ACRQGVPVSVNNLLGFNVSIHSKSKDKKSPLHFAASYGRINTCQRLLQDISDTRLLNEGD
LHGMTPLHLAAKNGHDKVVQLLLKKGALFLSDHNGWTALHHASMGGYTQTMKVILDTNLK
CTDRLDEEGNTALHFAAREGHAKAVAMLLSYNADILLNKKQASFLHIALHNKRKEVVLTT
IRNKRWDECLQVFTHNSPSNRCPIMEMVEYLPECMKVLLDFCMIPSTEDKSCQDYHIEYN
FKYLQCPLSMTKKVAPTQDVVYEPLTILNVMVQHNRIELLNHPVCREYLLMKWCAYGFRA
HMMNLGSYCLGLIPMTLLVVKIQPGMAFNSTGIINGTSSTHEERIDTLNSFPIKICMILV
FLSSIFGYCKEVIQIFQQKRNYFLDYNNALEWVIYTTSIIFVLPLFLNIPAYMQWQCGAI
AIFFYWMNFLLYLQRFENCGIFIVMLEVIFKTLLRSTGVFIFLLLAFGLSFYVLLNFQDA
FSTPLLSLIQTFSMMLGDINYRDAFLEPLFRNELAYPVLTFGQLIAFTMFVPIVLMNLLI
GLAVGDIAEVQKHASLKRIAMQVELHTNLEKKLPLWYLRKVDQRSTIVYPNRPRHGRMLR
FFHYFLNMQETRQEVPNIDTCLEMEILKQKYRLKDLTSLLEKQHELIKLIIQKMEIISET
EDEDNHCSFQDRFKKERLEQMHSKWNFVLNAVKTKTHCSISHPDF
NT seq 3378 nt   +upstreamnt  +downstreamnt
atgaagcgcggcttgaggaggattctgctcccggaggaaaggaaggaggtccagggcgtt
gtctatcgcggcgtcggggaagacatggactgctccaaggaatcctttaaggtggacatt
gaaggagatatgtgtagattagaagacttcatcaagaaccgaagaaaactaagcaaatat
gaggatgaaaatctctgtcctctgcatcacgcagcagcagaaggtcaagttgaactgatg
gaactgatcatcaatggttcttcgtgtgaagtgctgaatataatggatggttatggaaat
accccactgcattgtgctgcagaaaaaaatcaagttgaaagtgtaaagtttcttctcagc
caaggagcaaatccaaacctccgaaatagaaacatgatgtcaccccttcacatagctgtg
catggcatgtacaacgaagtgatcaaggtgttgactgagcacaaggccactaacatcaat
ttagaaggagagaatgggaacacggctttgatgtccacgtgtgccaaagacaacagtgaa
gctttgcaaattttgttagaaaaaggagctaagctgtgtaaatcaaataagtggggagac
taccctgtgcaccaggcagcattttcaggtgccaaaaaatgcatggaattaatcttagca
tatggtgaaaagaacggctacagcagggagactcacattaattttgtgaatcacaagaaa
gccagccctctccacctagcagttcaaagcggagacttggacatgattaagatgtgcctg
gacaacggtgcacacatcgacatgatggagaatgccaaatgcatggccctccattttgct
gcaacccagggagccactgacatcgttaagctcatgatctcatcctataccggaagtagt
gatattgtgaatgcagttgatggcaatcaggagaccctgcttcacagagcctcgttattt
gatcaccatgacctggcagaatacctaatatcagtgggagcagacatcaacagcactgat
tctgaaggacgctctccacttattttagcaacagcttctgcatcctggaacattgtgaat
ttgctcctctgtaaaggtgccaaagtagacataaaagatcatcttggacgtaactttttg
catttgactgtgcagcagccttatggactaagaaatttgcggcctgagtttatgcagatg
caacacatcaaagagctggtgatggatgaagacaatgacggatgcacacctctccattat
gcctgtaggcagggggttcctgtctctgtaaataacctccttggcttcaatgtgtccatt
catagcaaaagtaaagataagaagtcgcccctgcattttgcagccagttatgggcgcatc
aatacatgtcagagacttctgcaagacataagtgatacgaggcttttgaatgaaggggat
ctccatgggatgacccctctccacctggcagcaaaaaatgggcatgataaagtcgttcaa
ctccttctgaagaaaggggccttatttctcagtgaccacaatggctggactgctttgcat
cacgcctccatgggtgggtacactcagaccatgaaggtcattcttgatactaacttgaaa
tgcacagaccgactagatgaagaagggaacacagcactccactttgcagcacgggaaggc
catgccaaggctgttgcaatgcttttgagctacaatgctgacatcctcctgaacaagaag
caagcttcctttctgcatattgccctgcacaataagcgcaaggaagtggttctcacaacc
atcagaaataaaagatgggatgagtgtcttcaagttttcactcataattctccaagcaat
cgatgtccaatcatggagatggtagaatacctccccgagtgcatgaaagttcttttagat
ttctgcatgataccttccacagaagacaagtcctgtcaagactaccatattgagtataat
ttcaagtatctccaatgcccattatccatgaccaaaaaagtagcacctacccaggatgtg
gtatatgagcctcttacaatcctcaatgtcatggtccaacataaccgcatagaactcctc
aaccaccctgtgtgtagggagtacttactcatgaaatggtgtgcctatggattcagagcc
catatgatgaacctaggatcttattgtcttggtctcatacccatgacccttcttgttgtc
aaaatacagcctggaatggccttcaattctactggaataatcaatggaactagtagtact
catgaggaaagaatagacactctgaattcatttccaataaaaatatgtatgattctagtt
tttttatcaagtatatttggatattgcaaagaagtgatccaaattttccaacagaaaagg
aattacttcctggattacaacaatgctctggaatgggttatctatacaactagtatcatc
ttcgtgttgcccttgttcctcaacatcccagcgtatatgcagtggcaatgtggagcaata
gcgatattcttctactggatgaacttcctactgtatcttcaaaggtttgagaactgtgga
attttcattgttatgttggaggtgatttttaaaacattgctgagatcgaccggagtgttt
atcttcctcctactggcttttggcctcagcttttatgttctcctgaatttccaagatgcc
ttcagcaccccattgctttccttaatccagacattcagtatgatgctaggagacatcaat
tatcgagatgccttcctagaaccattgtttagaaatgagttggcatacccagtcctgacc
tttgggcagcttattgccttcacaatgtttgtcccaattgttctcatgaacttactgatt
ggcttggcggttggggacattgctgaggtccagaagcatgcgtcattgaagaggattgct
atgcaggtggaacttcataccaacttagaaaaaaagctgccactctggtacttacgcaaa
gtggatcagaggtccaccatcgtgtatccaaatagacccaggcacggcaggatgctacgg
ttttttcattactttcttaatatgcaagaaacacgacaagaagtaccaaacattgacaca
tgcttggaaatggaaatattgaaacagaaatatcggctgaaggacctcacttccctcttg
gaaaagcagcatgagctcatcaaactcatcatccagaagatggagatcatctcagagaca
gaagatgaagataaccattgctctttccaagacaggttcaagaaggagaggctggaacag
atgcacagcaagtggaattttgtcttaaacgcagttaagactaaaacacattgttctatt
agccacccggacttttag

DBGET integrated database retrieval system