KEGG   Mus musculus (mouse): 277360
Entry
277360            CDS       T01002                                 

Gene name
Prex1, G630042G04, P-RE, P-REX1, Setd6
Definition
(RefSeq) phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 1
  KO
K12365  phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchanger 1 protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04062  Chemokine signaling pathway
mmu05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    277360 (Prex1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    277360 (Prex1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    277360 (Prex1)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   277360 (Prex1)
SSDB
Motif
Pfam: RhoGEF DEP PDZ_6 PDZ PH PH_10
Other DBs
NCBI-GeneID: 277360
NCBI-ProteinID: NP_808450
MGI: 3040696
Ensembl: ENSMUSG00000039621
Vega: OTTMUSG00000001160
UniProt: Q69ZK0
Position
2; 2 H3
AA seq 1650 aa
MEAPGSGGGDGGGDPGGDGAHPDARGPVSGPCAAARDSERQLRLRLCVLNEILGTERDYV
GTLRFLQSAFLQRIRQNVADSVEKGLTEENVKVLFSNIEDILEVHKDFLAALEYCLHPEP
QSQHELGNVFLKFKDKFCVYEEYCSNHEKALRLLVELNKVPAVRAFLLSCMLLGGRKTTD
IPLEGYLLSPIQRICKYPLLLKELAKRTPGKHPDHTAVQSALQAMKTVCSNINETKRQME
KLEALEQLQSHIEGWEGSNLTDICTELLLQGNLLKISAGNIQERAFFLFDNLLVYCKRKS
RVTGSKKSTKRTKSINGSLYIFRGRINTEVMEVENVEDGTADYHSNGYTVTNGWKIHNTA
KNKWFVCMAKTAEEKQKWLDALIREREQRESLKLGMERDAYVMIAEKGEKLYHMMMSKKV
NLIKDRRRKLSTVPKCFLGNEFVAWLLEIGEISKTEEGVNLGQALLENGIIHHVSDKHQF
KNEQVMYRFRYDDGTYKARSELEDIMSKGVRLYCRLHSLYAPVIKDRDYHLKTYKSVVPG
SKLVDWLLAQGDCQTREEAVALGVGLCNNGFMHHVLEKSEFKDESQYFRFHADEEMEGTS
SKNKQLRNDFKLVENILAKRLLIPPQEDDYGFDLEEKNKAVVVKSVQRGSLAEMAGLQAG
RKIYSINEDLVFLRPFSEVETILNQFFCSRRPLRLLVATKAKETIKVPDHPEALSFQIRG
TAPPCVFAVGRGSEAVAAGLCAGQCILKVNGTSVANDGALEVLEHFQAFRNHREEALGLY
QWVYHSHEDAQLARASQGAPDEDPQEDDQPDSALPLLSLGPQLSLHEDSAVVSLTLDNVH
LEHGVVYEYMSTAGAKCHVLEKIVEPRGCFRLAAKILEAFAVDDSIFVQNCGRLMAMSSA
IVTMSHYEFHNICDTKLESIGQRIACYQEFAAQLKSRVSPPFKQASLEPHPLCGLDFCPT
NCHVNLMEVSYPKTTPSVGRSFSIRFGRKPSLIGLDPEQGLNPMAYTQHCITTMAAPSWK
CSPAVDEDSQGQGLNDSSYGSASGAPSQQDRGLSFLLKQEDREIQDAYLQLFTKLDVALK
EMKQYVTQINRLLSTITEPTSAAPAPCDPSLVEETSSSPPVSEESEVDRTDHSGIKKVCF
KVSEDEQEDSGHDTMSYRDSYSECNSNRDSVLSYTSVRSNSSYLGSDEMGSGDELPCDMR
IPSDKQDKLHGCLEHLFNQVDSIHALLKGPVMSRAFEETRHFPMKHSWQEFKQKEECTVR
GRNLIQISIQEDPWNLPSSIRTLVDNIQQYVEDGKNQLLLALLKCTDTELQLRRDAVFCQ
ALVAAVCTFSEQLLAALDYRYNNNGEYEESSRDASRKWLEQVAATGVLLHWQSLLAPASV
KEERTMLEDIWVTLSELDNVTFSFKQLDENSVANTNVFYHIEGSRQALKVVFYLDGFHFS
RLPSRLEGGASLRLHTVLFTKALESVEGPPPPGNQAAEELQQEINAQSLEKVQQYYRKLR
AFYLERSNLPTDAGATAVKIDQLIRPINALDELYRLMKTFVHPKAGAAGSLGAGLIPVSS
ELCYRLGACQITMCGTGMQRSTLSVSLEQAAILARSHGLLPKCVMQATDIMRKQGPRVEI
LAKNLRIKDPMPQGAPRLYQLCQPPVDGDL
NT seq 4953 nt   +upstreamnt  +downstreamnt
atggaggcacccggcagcggtggtggtgacggcggcggggacccaggcggggacggtgcg
catcccgatgctcgcggccccgtctccgggccgtgcgcggccgcccgcgactcggagcgc
cagctgcgcctccgtctgtgcgtactcaacgagatcctgggcaccgagcgcgactacgtg
ggcaccttgcgtttcctgcagtcggccttcctacagcggatccggcagaatgtggccgac
tctgtggagaagggcctcacagaagagaatgtcaaggtcctcttctccaacattgaggac
atcctggaagtccataaggattttctggctgccctggagtactgcttacaccccgagcct
cagtctcagcacgaacttgggaatgttttcttgaaatttaaggacaagttctgtgtgtat
gaggagtactgcagcaaccacgagaaggccctgcgcctgttggtggagctcaacaaggtc
cctgctgtgcgtgccttcctcctgagctgcatgcttctggggggccggaagaccactgac
attcctctggaaggctacctgctgtccccgatccagagaatctgcaagtacccgctcctg
ctcaaggagttggccaagaggacccccggcaagcaccctgaccacaccgcggtacagagt
gccctgcaggccatgaagactgtctgctccaacatcaatgagactaagaggcagatggag
aagctggaggccctggagcagctgcagtctcacattgaaggctgggagggctccaacctc
acagacatctgcaccgagctcctccttcagggcaacctgctgaagatctctgcgggcaac
atccaagagagagccttcttcctctttgacaacctgcttgtctactgcaagcggaagtct
agggtcactgggagcaagaaatctaccaaaaggaccaagtccatcaacggctccctgtac
atctttaggggtcggatcaacactgaggtcatggaagtggagaatgtggaggatgggaca
gccgattaccacagcaatggctacactgtcaccaatggctggaagatccacaacaccgcc
aaaaacaagtggttcgtgtgtatggccaagacggcggaggagaaacagaagtggctggat
gccctgatccgagagcgggagcagcgagagagcctgaagctgggcatggagcgtgacgcg
tacgtcatgattgcggagaagggggagaagctgtatcacatgatgatgagcaagaaggtg
aacttgatcaaggaccgccggcggaagctgagcaccgtccccaagtgcttccttggcaat
gagtttgttgcctggctcctggaaattggtgagatcagcaagacggaagaaggcgtcaac
ttgggccaagccctgctggagaatggtatcatccaccatgtctctgacaagcaccagttc
aagaacgagcaggtgatgtaccgcttccgctacgacgacggcacttacaaagcgcgcagc
gagctggaggatatcatgtccaagggcgtgagactctactgccggctgcacagcctgtac
gcccctgtgatcaaggaccgtgattaccacctgaagacctacaagtccgtggtccccggg
agcaagctggtagactggctactggcacagggggactgccagacacgggaggaggccgtg
gcgcttggtgtgggcctgtgcaacaacggttttatgcaccatgttctggagaagagcgaa
ttcaaggatgagtcccagtacttccgcttccatgctgatgaggagatggaggggaccagc
agcaagaacaaacagcttcgcaatgacttcaagctggtggagaacatcctggcaaagcga
ctgctgatcccgccacaggaggacgactatggcttcgaccttgaggagaagaacaaggct
gtggtagtgaagtctgtgcagaggggctcgctggctgagatggctggcctgcaggctggg
aggaagatttactccatcaacgaggacctggtgttcctgcgtcccttctctgaggtggag
accatcctcaaccagttcttctgctcccgccgcccgctccgcctcctggtggccaccaag
gccaaagagaccatcaaagtccctgaccacccagaggccctgtccttccagattcgagga
acagccccgccgtgtgtctttgctgtgggcagaggctctgaggctgtggctgccgggctc
tgcgcgggccaatgcatcctgaaagtcaacggcaccagcgtggcgaatgatggcgccctg
gaggttctcgagcacttccaggctttccgcaaccacagggaggaggccctgggtctttac
cagtgggtctaccacagccacgaggatgcccagctggcacgagccagccagggtgcccct
gatgaggacccccaggaagatgaccagcctgactcagccctgcccctgctgtccctgggt
ccccagctgagtctgcatgaggacagcgctgtggtcagcctgacgctggacaatgttcac
ttggagcacggtgtggtttacgaatacatgagcactgcaggagccaagtgtcacgtgctg
gagaagatcgtggagccccgaggctgtttccgccttgctgccaagatccttgaggccttt
gctgtggacgacagcatcttcgtgcagaactgtgggcggctcatggccatgagcagtgcc
attgtcaccatgtcccactacgagttccataacatctgtgacaccaagctggagagcatc
ggccagaggatcgcctgctaccaggagtttgcagcccagctgaagagtagggtcagcccc
cccttcaagcaggcatccctggagccccacccgctgtgtggccttgacttctgccccacc
aactgtcacgtcaacctcatggaagtgtcctaccccaagaccacaccttcggtgggcagg
tccttcagcatccgcttcggacgcaaaccctccctcatcggccttgacccagaacaaggc
ctgaaccccatggcctatacccagcactgtatcaccaccatggctgccccgtcctggaag
tgctcacctgctgtagacgaggactcccaaggccagggtctcaatgacagcagctatggg
tcagccagtggtgccccgagccagcaagaccgcggcctgagctttctgctcaaacaggaa
gaccgtgagatccaggacgcatacctgcagctcttcactaagctggacgtggccctcaag
gagatgaagcagtatgtcacccagattaacaggctgctgtcaaccatcacagagcccaca
tcagctgcccctgcgccctgtgacccatccttggtggaggagacctcatcttccccaccg
gtcagtgaggagagtgaagtggaccggactgaccacagcggcatcaagaaagtgtgcttc
aaggtgtcggaggacgagcaggaagactcgggccacgacaccatgagctaccgcgactcc
tacagtgagtgtaacagcaatcgggactctgtcctgtcctacaccagcgtgagaagcaac
agttcgtacctgggtagtgacgagatgggctcaggggatgagctgccctgtgacatgcgc
atcccgtccgacaagcaggacaaacttcacggctgcctggaacatctctttaaccaggtc
gattccatccatgccctgctcaaggggcctgtgatgagcagggcatttgaggagaccagg
catttccccatgaagcacagctggcaagagttcaaacagaaagaggaatgcacggtccga
gggcggaacttgattcagatcagtatccaggaggacccttggaacctgcccagctccatc
aggaccctggtggacaacatccagcaatacgtggaagatggaaagaaccagctgcttctg
gctctgctcaagtgcacagacacggagctgcagctgcgcagggatgctgtcttctgtcag
gctctggtggccgccgtgtgcactttctcggagcagctgctggccgcccttgactaccgc
tacaacaacaacggcgagtatgaagagagcagcagagatgccagccgcaagtggctggag
caggtggcggctacaggtgtcctgctgcactggcagtctctgctggcaccagcctccgtg
aaggaggaacggaccatgctggaggacatctgggtgacgctgtcggagctggacaatgtc
accttctcctttaagcagctggatgagaattctgtggccaacaccaatgtcttctaccac
atcgagggcagtaggcaggcactgaaggtagtcttctacctcgatggcttccacttctcc
aggctgccctctcgcctagagggtggggccagcctcaggctgcacacggtgctcttcaca
aaagcactggagagcgtggaagggcccccgccccctggaaaccaggcagcagaagagctg
cagcaggagatcaacgcacagtccctggagaaggtgcagcagtactatagaaagctcagg
gcgttctacctggagcggtccaacctgcccacggatgctggcgccacagctgtgaagatt
gaccagctgattcgtcccatcaatgccctggatgagctctaccgcctcatgaagaccttc
gtgcaccccaaagcgggtgctgctgggagcctgggtgctggtctcatccccgtctcctcc
gagctctgctatcgcctgggggcgtgtcagatcaccatgtgtggcaccggcatgcagcgg
agcaccctgagcgtgtccttggaacaagcagccatcttggcacggagtcacggcctgttg
cccaagtgtgtcatgcaggccacagacatcatgcgcaagcagggcccccgagtggagatt
ctggccaaaaacctccgcatcaaggaccccatgccccaaggtgcaccacgcctctaccag
ctctgccagcctccggtggatggagacctctga

DBGET integrated database retrieval system