KEGG   Mus musculus (mouse): 277463Help
Entry
277463            CDS       T01002                                 

Gene name
Gpr107, 9930033D15Rik, AI790205, C530034M11, mKIAA1624
Definition
(RefSeq) G protein-coupled receptor 107
  KO
K22985  G protein-coupled receptor 107
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    277463 (Gpr107)
G protein-coupled receptors [BR:mmu04030]
 Others
  Others
   Neuronostatin
    277463 (Gpr107)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lung_7-TM_R GpcrRhopsn4 Sas10_Utp3
Motif
Other DBs
NCBI-GeneID: 277463
NCBI-ProteinID: NP_848875
MGI: 2139054
Ensembl: ENSMUSG00000000194
Vega: OTTMUSG00000011925
UniProt: Q8BUV8 Q148Z6
Position
2; 2 B
AA seq 551 aa AA seqDB search
MAVPVPLGRFGSFCLRLLRLLALLELLVHPVLGRVHHLALKDDVRHKVHLNTFGFFKDGY
MVVNVSSLSVNEPEGATDKDAEIGFSLDRTKNDGFSSYLDEDVNYCILKKKSMSSVTLVI
LDISGSIVKVRSPPEAGKQLPEIVFSKDEKILSQSQEPAVSSNPKDSEARRTLDGFKAGR
STVDSKAITERSFSIHKNDGVVSFQFFFNISTDDQEGLYSLYFHKCSGNNVKPGEQASFS
LNIAITEKNPNSYLSAGEIPLPKLYVSMALFFFLSGTIWIHILRKRRNDVFKIHWLMAAL
PFTKSLSLVFHAIDYHYISSQGFPIEGWAVVYYITHLLKGALLFITIALIGTGWAFIKHI
LSDKDKKIFMIVIPLQVLANVAYIIIESTEEGTTEYGLWKDSLFLVDLLCCGAILFPVVW
SIRHLQEASATDGKAAINLAKLRLFRHYYVLIVCYIYFTRIIAFLLKFAVPFQWKWLYQL
LDETATLVFFVLTGYKFRPASDNPYLQLSQEDDDLEMESVVTTSGVMENMKKVKKVSNGA
VEPQGSWEGTA
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atggccgtcccggtacccctcggccgcttcggctccttctgcctgcggctgctacgactg
ctggcgttgctggagctgctggtccaccccgtcttgggccgcgtccatcacctggcgctc
aaagatgatgtgcggcataaagtccatctcaacaccttcgggttcttcaaggatgggtac
atggtggtcaacgtcagcagcctctctgtgaacgagcctgagggagccacggacaaggat
gctgagatcggattcagtctggatcggactaagaacgatggcttttcttcttacctggat
gaagatgtgaattactgtattttaaaaaagaagtccatgtcttctgtcactcttgtcatc
ttagacatctctggaagcatagtcaaggtcagatccccaccagaagctggtaagcagtta
ccagagattgtcttcagcaaggatgagaaaatcctgagtcagagccaggagcctgctgtc
agctccaaccccaaagacagtgaggctcggagaaccctcgatggtttcaaggctggacga
agtacagtggactcaaaggctatcacagagcgatccttctcaattcacaagaatgacggg
gtggtctcatttcagttcttctttaacatcagcaccgatgaccaggaaggcctctacagc
ctttacttccacaagtgctcaggcaacaacgtgaagcctggtgaacaggcctcattcagc
ctgaatattgctatcacagagaagaaccctaacagctacctctctgccggggaaatccct
ctccccaagttatatgtttccatggccttgttcttctttctgtctgggaccatttggatt
cacatccttcgtaagagaaggaatgatgtatttaaaattcactggttgatggccgccctt
cctttcaccaagtctctctcgttggtgttccatgcaatcgactaccactacatctcctcg
cagggctttccgattgaaggctgggctgttgtatactacataactcacctgctaaagggc
gcactcctgttcatcaccatcgccctcatcggcactggctgggccttcatcaagcacatc
ctgtctgataaagacaagaagatcttcatgattgtcatcccgctccaggtcctggcgaat
gtggcctacatcatcatagagtccactgaggagggcacaactgagtatggcctatggaag
gactctctgttcctggttgacttgctttgctgtggcgccatcctcttcccagtggtgtgg
tcaatcaggcatttacaagaagcctccgccacagatggaaaagctgccattaacttagcg
aagctgaggcttttcagacattactacgtcttgattgtgtgctacatctactttaccagg
atcatcgccttccttctcaagtttgctgttccattccagtggaagtggctctaccagctg
ctggatgaaacagccacgctggtgttctttgtcctgacggggtataaatttcgcccagct
tcagataacccctacctgcagctctctcaggaagatgatgacctggagatggagtccgta
gtgacgacatcgggtgtgatggagaatatgaagaaggtgaagaaagtgagcaacggtgct
gtggagccccagggcagctgggaaggcaccgcgtga

DBGET integrated database retrieval system