KEGG   Mus musculus (mouse): 27756
Entry
27756             CDS       T01002                                 

Gene name
Lsm2, D17H6S56E, D17H6S56E-, D17H6S56E-2, D17H6S56E2, Dm, Dmapl, Dmp, Dmpkap, G7b, Sm-X, Sm-X5, SmX, SmX5, snRNP
Definition
(RefSeq) LSM2 homolog, U6 small nuclear RNA and mRNA degradation associated
  KO
K12621  U6 snRNA-associated Sm-like protein LSm2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03018  RNA degradation
mmu03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    27756 (Lsm2)
  09123 Folding, sorting and degradation
   03018 RNA degradation
    27756 (Lsm2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    27756 (Lsm2)
   03041 Spliceosome [BR:mmu03041]
    27756 (Lsm2)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     27756 (Lsm2)
  mRNA degradation factors
   5'-3' decay
    Lsm complex
     27756 (Lsm2)
Spliceosome [BR:mmu03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   LSm proteins
    27756 (Lsm2)
 Complex C
  U2 snRNP components
    27756 (Lsm2)
SSDB
Motif
Pfam: LSM SM-ATX
Other DBs
NCBI-GeneID: 27756
NCBI-ProteinID: NP_001103571
MGI: 90676
Ensembl: ENSMUSG00000007050
Vega: OTTMUSG00000037141
UniProt: O35900 O35901 Q3U9X2
Position
17 B1; 17 18.52 cM
AA seq 95 aa
MLFYSFFKSLVGKDVVVELKNDLSICGTLHSVDQYLNIKLTDISVTDPEKYPHMLSVKNC
FIRGSVVRYVQLPADEVDTQLLQDAARKEALQQKQ
NT seq 288 nt   +upstreamnt  +downstreamnt
atgctcttctactcctttttcaagtctcttgtgggcaaggatgtagtcgtggaactcaag
aatgacctgagcatctgtggaaccctccactctgtggaccagtacctcaatatcaaacta
accgacatcagtgtcacagaccctgagaaataccctcacatgttatcagtcaagaactgc
ttcatcaggggctcagtcgtccgctatgtgcagctgccagcagatgaggtggacacacaa
ctgctacaggatgcagcaaggaaggaagcccttcagcagaagcagtga

DBGET integrated database retrieval system