KEGG   Mus musculus (mouse): 278097Help
Entry
278097            CDS       T01002                                 

Gene name
Armcx6, AW060994
Definition
(RefSeq) armadillo repeat containing, X-linked 6
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: Arm_2
Motif
Other DBs
NCBI-GeneID: 278097
NCBI-ProteinID: NP_001007579
MGI: 2147993
Ensembl: ENSMUSG00000050394
Vega: OTTMUSG00000019457
UniProt: Q8K3A6
Position
X; X E3
AA seq 301 aa AA seqDB search
MGRAREMGWMAAGLMIGAGACYCMYKLTMGRSEGNELEDEEEDEWEDGQDLDEEEADNWF
DFTAMARPWSEDGDWDEPGAPGGTEDRRSGGGKANRAHPIKQRPFPYEHKNIWGEQSFKS
FTCILDLNKCVSTQRKKRFTKNINAGFSLSPNISKHLASLSVVGNRSPTPHPTVREKALF
VPENPNSSLENQGQIKMSIDEVCRETLLCCCKSFLQQAGLSLLISMTVINNMLAKSVSDL
KFPLLSKGSGCAEVRGLEELMSLSEKPVLVGEALAAQMLSSFMCLFTRSGSREMLVEAIS
P
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgggtcgggcccgggaaatgggttggatggcagccggactcatgattggagctggtgcc
tgttactgcatgtacaaactgaccatgggaagaagtgaggggaacgagctggaggacgag
gaggaagatgaatgggaagatggacaggatctggatgaagaggaagcagacaattggttt
gatttcacagcaatggctcgaccctggagtgaggatggggactgggatgaacctggggcc
ccaggtgggactgaggacagacggtcaggtggtggaaaggcaaacagagcacacccaatc
aagcagcggccattcccttatgaacataaaaacatatggggtgaacagagctttaaatcc
ttcacttgtattcttgacctgaacaagtgtgtttccactcaaagaaagaaaaggttcacg
aagaacataaatgctggcttttcccttagccccaatatcagtaaacatctggccagccta
tcagtggttggaaacaggagtcccaccccccatcccactgtgagggagaaggctctgttt
gtccctgaaaacccaaacagcagccttgaaaatcagggccagattaagatgtccattgat
gaagtgtgtcgagagacactgttgtgttgctgcaagtcttttctgcagcaggcaggatta
agtctgctaataagcatgacagtcattaataacatgcttgccaagtctgtttcagacctg
aagtttcctttgctatccaaggggagtggatgtgcagaggtgcggggcttggaagagctg
atgagtttgtctgaaaagccagtgctggtgggggaagcactggctgcccaaatgctctcc
tccttcatgtgcctctttaccagaagtgggagcagagagatgcttgtggaagccatctcc
ccttaa

DBGET integrated database retrieval system