KEGG   Mus musculus (mouse): 27878
Entry
27878             CDS       T01002                                 

Symbol
Tada1, 2900026B15Rik, D1Ertd251e, Staf42, Tad, Tada1l
Name
(RefSeq) transcriptional adaptor 1
  KO
K11317  transcriptional adapter 1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mmu03021]
    27878 (Tada1)
   03036 Chromosome and associated proteins [BR:mmu03036]
    27878 (Tada1)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     27878 (Tada1)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    STAGA complex
     27878 (Tada1)
SSDB
Motif
Pfam: SAGA-Tad1 TAF4
Other DBs
NCBI-GeneID: 27878
NCBI-ProteinID: NP_084521
MGI: 1196415
Ensembl: ENSMUSG00000026563
Vega: OTTMUSG00000026881
UniProt: Q99LM9
Position
1 H2.3; 1 73.74 cM
AA seq 335 aa
MATFVSELEAAKKNLSEALGDNVKQYWANLKLWFKQKISKEEFDLEAHRLLTQDNVHSHN
DFLLAILTRCQILVSTPEGAGSLPWTGGSAAKPGKPKGKKKLSSVRQKFDHRFQPQNPLS
GAQQFVAKEPQGDDDLKLCSHTMMLPTRGQLEGRMIVTAYEHGLDNVTEEAVSAVVYAVE
NHLKDILTSVVSRRKAYRVRDGHFKYAFGSNVTPQPYLKNSVVAYNNLVEGPPAFSAPCA
NQSPASQPHPDDAEQQAAFLLACSGDTLPASLPPVNMYDLFEALQVHREVIPTHTVYALN
IERIIMKLWHPNHEELQQDKVHRQRLAAKEGLLLC
NT seq 1008 nt   +upstreamnt  +downstreamnt
atggcgacctttgtgagcgagctggaggcagccaagaagaacttgagcgaggcgctgggg
gacaacgtgaaacaatactgggccaacctgaagttgtggttcaagcagaagatcagcaag
gaggagttcgaccttgaagctcacagactcctcacacaggacaatgtgcattctcacaat
gacttcctcctggccatcctcacacgttgtcagattttggtttctacaccagagggtgct
ggatctttgccctggacagggggctctgcagccaagcctggaaaacccaagggcaagaaa
aagctttcttctgttcgtcaaaaatttgatcataggttccagcctcagaaccccctctct
ggagctcagcagttcgtggcaaaggagccccagggtgatgacgacttgaaactttgttca
cacaccatgatgcttcccacgcgaggccaacttgaagggagaatgatcgtgactgcctat
gagcacgggctggacaatgtcactgaggaggccgtgtctgccgtggtctatgccgtggag
aatcacctcaaagatattctgacctcagttgtgtcgagaaggaaagcttaccgggtacgg
gatggtcattttaaatacgcctttgggagcaacgtgacgccacagccatacctgaagaat
agtgtggtggcttacaacaacttggttgaaggccctccagccttctctgctccatgtgcc
aatcagagcccagcgtctcagccacaccccgacgatgctgagcagcaggctgcattccta
ttggcctgctcgggggacacgctacctgcatctctgcctccagtgaacatgtatgacctg
tttgaagctttgcaggtccacagggaagtcattcctacacatactgtgtatgcccttaac
attgaaaggatcatcatgaaactctggcaccccaatcacgaagagctacaacaagacaaa
gtccaccgccagcgcctggcagccaaagaaggacttttgctctgctaa

DBGET integrated database retrieval system