KEGG   Mus musculus (mouse): 279028
Entry
279028            CDS       T01002                                 

Gene name
Adamts13, ADAM-TS13, ADAMTS-13, Gm710, vWF-CP
Definition
(RefSeq) a disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 13
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    279028 (Adamts13)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     279028 (Adamts13)
Peptidases and inhibitors [BR:mmu01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   279028 (Adamts13)
SSDB
Motif
Pfam: TSP1_ADAMTS TSP_1 ADAM_CR_2 Reprolysin Reprolysin_4 Reprolysin_3 Reprolysin_5 TSP1_spondin Peptidase_M10 Reprolysin_2 TSP1_CCN Sensor
Other DBs
NCBI-GeneID: 279028
NCBI-ProteinID: NP_001001322
MGI: 2685556
Ensembl: ENSMUSG00000014852
Vega: OTTMUSG00000011842
UniProt: Q769J6
Position
2; 2 A3
AA seq 1426 aa
MSQLCLWLTCQPCYAVSVRGILTGAIFILGCWGLSDFQKSLLQDLEPKDVSSYFGHHAAP
FTGHPPSHLQRLRRRRTLEDILHLELLVAVGPDVSRAHQEDTERYVLTNLNIGSELLRNP
SLGVQFQVHLVKLITLSDSESTPNITANITSSLMSVCEWSQTINPHDDRDPSHADLILYI
TRFDLELPDGNQQVRGVTQLGGACSLSWSCLITEDTGFDLGVTIAHEIGHSFGLDHDGAP
GSGSTCKASGHVMAADGATPTGGTLEWSACSQRQLQHLLSTGQMHCFQDPPGLQSGLTRH
QLMAQPGLYYSADDQCRVAFGSGAVACTFSREGLDVCQALSCHTDPLDQSSCSRLLVPLL
DGTECGVEKWCSKARCRSLAELAPVAAVHGHWSSWGPHSPCSRSCGGGVITRRRWCNNPR
PAFGGRACVGEDLQAKMCNTQACEKTQLEFMSEQCAQTDRQPLQLSQGTASFYHWDAAVQ
YSQGDTLCRHMCWAVGESFIVSRGDRFLDGTRCVPSGPQDDGTLSLCLLGSCRTFGCDGR
MDSQKVWDACQVCGGDNSTCSSRNGSFTAGRAREYVTFLIVTPNMTNAHIVNRRPLFTHL
AVRIQGHYIVAGKTSISPNTTYPSLLEDYRVEYRVTLTEDQLPHLEEIHIRGPVRDDIEI
QVYRRYGGEYGDLTHPDITFSYFQLKQQAAWVWTAKRGPCSVSCGAGLRWVTYSCQDQAQ
DKWVKNAQCQGSPQPPAWQEPCVSAPCSPYWVAGDFSPCSVSCGGGLRERSLRCVETQDG
FLKTLPPARCRAVAQQPAAEVENCNSQPCPTRWEVSDPGPCMSSACEAGLDSRNVTCVSR
AGDPEKPETAGPCRTDEMSAMLEPCSRSLCSPGLGQVDNTMSLGEEAPSPVGSDKPGAQA
EHVWTPLVGLCSISCGRGLKELYFLCMDSVLKMPVQEELCGLASKPPSRWEVCRARPCPA
RWETQVLAPCPVTCGGGRVPLSVRCVQLDRGHPISVPHSKCSPVPKPGSFEDCSPEPCPA
RWKVLSLGPCSASCGLGTATQMVACMQLDQGHDNEVNETFCKALVRPQASVPCLIADCAF
RWHISAWTECSVSCGDGIQRRHDTCLGPQAQVPVPANFCQHLPKPMTVRGCWAGPCAGQE
TSSSLPHKEATLPSQTQAAATVASLQWSQPRARTPTLFSASQSLGLQENLEEHGACGRQY
LEPTGTIHMRDQGRLDCVVAIGRPLGEVVTLQILESSLKCSAGEQLLLWGRFTWRKTCRK
MPGMTFSTKTNTVVVKQHRVLPGGGVLLRYWSQPAPGTFYKECDRQLFGPRGEIVSPSLS
PDGRKAGTCRVFISVAPQARIAIRALASDMGTASEGTNANYVSIRDIHSLRTTTFWGQQV
LYWESEGSEAELEFSPGFLEAHASLQGEYWTISPRTSEQDDSLALS
NT seq 4281 nt   +upstreamnt  +downstreamnt
atgagccagctttgcctgtggttgacgtgccagccttgttatgctgtcagtgtcagagga
atcctcactggtgccatcttcattctgggctgctgggggctctctgacttccagaagagt
cttcttcaagatctggagcccaaggatgtgtcttcttactttggccaccatgctgctcca
ttcacaggccatcctccctctcacctccagagactgagacggagaaggactttggaggac
attctgcacctggaactcctggtagctgtgggccccgatgtttcccgggctcatcaggag
gacacagaacgctacgtgctcactaatctcaatatcgggtcagaactgttgagaaaccca
tccctgggagtccagttccaggtgcacctggtgaagctaatcaccctctctgactcagag
agtactccgaatatcacggccaacatcacctcatccttgatgagcgtctgcgagtggagc
cagacgatcaacccccacgatgacagggatccaagtcacgctgacctgattctctatatc
accaggtttgacctggagttgcctgatggcaaccagcaggttcggggtgtcacccagctg
ggaggtgcctgctccctttcctggagttgccttatcactgaggatactggctttgacctg
ggggtcaccatcgcccatgagattgggcacagcttcgggctggaccatgatggtgctcca
ggtagtggcagcacctgcaaggccagtggccacgtgatggcggctgatggcgcaacacct
actggagggaccctggagtggtctgcctgcagccaaaggcagttgcagcacctactcagc
acagggcaaatgcactgcttccaggacccacctgggctgcagtcaggacttacacggcac
cagctgatggcacagcctggcctctactacagtgcagatgatcagtgccgtgtggctttc
ggttctggggctgtcgcctgcaccttctccagggagggtctggatgtatgccaggccctg
tcctgccacacagaccccttggaccaaagcagctgcagccgcctccttgttcctctcctg
gatgggacagaatgtggtgtggagaagtggtgctccaaggctcgctgtcgctccctagct
gagctggctcctgtggctgcagtacatggacactggtctagctggggcccccatagtccc
tgctcccgatcctgtggaggaggtgtgattaccaggaggcggtggtgcaacaaccccagg
cctgcatttgggggacgtgcatgtgtgggtgaagacctccaggctaagatgtgcaacacg
caggcttgtgagaagactcagctggagttcatgtccgagcagtgtgcccagacagacaga
caaccactgcaactttcccaaggcactgcctccttctaccactgggatgctgctgtgcag
tatagtcaaggagataccctgtgcagacacatgtgctgggctgttggagaaagcttcatt
gtcagccgtggggacaggttcctagatgggacccgttgtgtgccaagtggtcctcaggat
gatgggaccctaagcctctgtttgttgggcagctgcaggacctttggctgtgatggcagg
atggactcccagaaggtttgggatgcgtgccaggtgtgtggaggagacaacagcacctgc
agctcacggaatggttctttcacagctgggagagccagagaatatgtcacgttcctgatt
gttactcccaacatgaccaacgcacacattgtcaaccgcaggcctctcttcacacacttg
gcggtgaggatccagggccactacattgtggcagggaagactagcatctcacccaacacc
acctacccttcccttctggaggactaccgtgtggaatacagagtgactctcactgaggac
cagctgccccacttagaggagattcacatccggggacccgtccgggatgacattgagatt
caggtgtacagacgatatggaggagaatatggggatcttacacacccagacatcaccttt
tcctactttcaactgaagcagcaggcagcctgggtatggaccgctaagcgtggaccctgc
tcagtgagctgtggggcagggctgcgctgggtgacctacagctgccaggatcaagctcaa
gacaagtgggtaaagaacgcccagtgccaagggagcccacagccacctgcatggcaagag
ccttgtgtctctgccccctgctccccatattgggtagctggggacttcagcccatgtagc
gtgtcttgtggcgggggccttcgggagcggtcactgcgctgtgtagagacccaagatggc
ttcttaaagacactgccacctgcccggtgcagagcagtagcccagcagccagcagcagaa
gtggaaaactgcaactcccagccctgtcccaccaggtgggaggtgtcagaccctggccct
tgcatgtcatctgcctgtgaggcaggtctggactcaaggaatgtgacatgtgtgtccagg
gcgggtgacccggagaagccagaaactgcaggcccctgccgcaccgacgagatgtcagct
atgctggagccctgctccaggagcctgtgttctccaggcttgggtcaggtggacaacacc
atgtctctgggagaggaggctccatccccggtgggcagtgacaagccaggggctcaggct
gagcatgtgtggacccctctggtggggctgtgctccatctcttgtgggagaggtctgaag
gaactgtatttcctgtgcatggattctgtcctcaaaatgcctgtccaggaagagctatgc
ggcttggctagtaagcccccaagccggtgggaggtctgcagggctcgcccctgtcctgct
cggtgggagactcaagtcttggcaccgtgcccggtgacctgtggtggggggcgagtgcca
ctgtctgttcgttgtgtgcagctagaccgtggccacccgatatctgtacctcactccaag
tgctcgccagtgcctaagccaggctccttcgaggactgcagccctgagccttgtcctgct
agatggaaagtcctgtcccttggcccatgctcagccagctgtggccttggcactgccaca
caaatggtggcctgcatgcagcttgaccagggccatgacaatgaggtgaatgaaactttc
tgtaaggctctagtgcggcctcaggccagtgtcccctgcctcattgctgactgcgcattc
cggtggcacatcagcgcctggacagagtgctctgtctcctgtggggacggtattcagcgc
cggcatgacacctgccttggaccccaggcccaagtgcctgtgccagccaatttctgccag
cacctgcccaagccaatgaccgtgagaggctgctgggctggaccctgtgcagggcaggag
acctccagctcactgcctcacaaggaagctactcttcccagtcagacccaggctgctgct
actgttgcttctctgcagtggtcccagccccgagcccggacccccacccttttctcagcc
tcccagtctctggggctccaggaaaacctggaagagcatggtgcctgtggaaggcagtac
ctggagcccacaggaaccattcacatgcgagatcaaggacggctagactgtgtggtggcc
attgggagacctctaggtgaagtggtgaccctacaaatccttgagagctccctcaagtgt
agtgcaggggagcaactgctgctctggggtaggttcacatggaggaagacatgcaggaag
atgcctggcatgactttcagcaccaaaaccaacacagtggtggtgaagcagcatcgtgtg
ctgccagggggtggagtgctgctacggtactggagtcaacctgccccggggaccttctac
aaagaatgtgacaggcagctctttggacctcggggtgaaattgtgagtccctcactgagc
ccagacgggaggaaggcagggacctgcagggtcttcatcagtgtggctccacaggcccgc
attgccatccgcgccctggccagtgatatgggcactgcttctgaggggaccaatgccaac
tatgtctcgatcagggacatccacagtctgaggaccacaacattttgggggcagcaggtg
ctctactgggagtccgaaggcagcgaggctgaactggagtttagccctggcttcctggag
gcacatgccagtctccagggcgagtattggaccatctcacctaggacatcggaacaggac
gacagcctggctctgtcctag

DBGET integrated database retrieval system