KEGG   Mus musculus (house mouse): 279499
Entry
279499            CDS       T01002                                 
Symbol
Kctd19, 4922504H04Rik
Name
(RefSeq) potassium channel tetramerisation domain containing 19
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: BTB_2
Other DBs
NCBI-GeneID: 279499
NCBI-ProteinID: NP_001288102
MGI: 3045294
Ensembl: ENSMUSG00000051648
Vega: OTTMUSG00000036565
UniProt: Q562E2
Position
8:complement(106109433..106140134)
AA seq 927 aa
MEEPGGLHESAEDLFHFNVGGWHFSVPRSKLAQFPDSLLWKEASALTSSENQRLFIDRDG
STFRHVHYYLYTSKLSFSSCAELNLLYEQALGLQLMPLLQTLDNLKEGRHHLRVRPADIP
VAERASLNYWRTWKCISKPSDFPIKSPAFTGLHDKAPLGLMDTPLLDTEEEVHYCFLPLD
LVAKYPSLVTEDNLLWLAETVALIECECSEFRFIVNFLRSHKILLPDNFSNIDVLEAEVE
ILEIPELTEAVRLYRMNMGGCSRTSCPPLSPGKGGRTASVESVKPLYLMALGLLVKYPDS
ALGQLRIESTLDGSRLYITGNGALFQHVRNWLGTCRLPLTETISEVYELCAFLDKRDITY
EPMKVALKTHLEPRTLLPVDVLSEEWTAEVTIYSPQQIIKLYVGSHWYATTLQTLMKYPE
LLSNTQRVYWIAYGQTLLIHGDGQMFRHILNFLRLGKLFLPSEFKEWPLFCQEVEEYHIP
ALSEALAQCEAYKSWTQEKESENEEAFPIRKLHVVTEGTGPMAEFSRDAKETTACMPVDF
QECSDRTPWNKAKGNLTRSSQMEEAEQYTRTIQVSLCRNAKRGGNPSTYSHCSGLCANPR
HWGGHSESPPKKKCTTINLTQKPDAKDPPVTPMQKLISLVREWDMVNCKQWEFQPLPASR
SSSVEEASLHVPSGSEAAPQPGTSAAWKAHSITSEKDAGPQTGPGAGVKDKGPEPTFKPY
FPTKRAITLKDWGKQRPKDRESPAPEQPLPNANGTDNPGAILKVAHPPVVGNDGSCMFFE
DSIIYTTQMDNIKHTSLTASPQLREVTFLSFSLSWEEMFYAQKCHRFLTDIILDSIRQKD
PKAITAKVVSLAYRLWTLNISPKQFVVDLLAIAGFKDDRHTQERLYSWVELTLPFARKYG
RCVDLLIQRGLSRSVSYSVLGKYLHEG
NT seq 2784 nt   +upstreamnt  +downstreamnt
atggaggagcctggcgggctccatgagtcagcagaggatttgtttcacttcaatgtcggg
ggctggcatttctcagttcccaggagcaaacttgctcagttcccagactcgctgttgtgg
aaagaggcttcagccctgacctcttcagagaaccagcggctcttcattgacagagacggc
tccacgtttaggcatgtgcactattacctctacacgtccaagctctccttctccagttgt
gcagaactgaacttgctctatgagcaagccctgggtttgcagctgatgcccttgcttcag
accctagataacctgaaggaagggagacaccacctccgtgtgcggcctgccgacattcct
gtggctgagagagcatccctgaactactggcggacatggaagtgtatcagcaagccctcg
gattttccaataaaaagccccgccttcacaggtcttcatgacaaggcccctttgggactc
atggacacaccgctgttggacacagaagaggaagtgcactactgcttcttacccctcgac
ttggtggccaagtacccaagcctagtgaccgaagacaatctgctgtggctggctgaaacg
gtggccctgatcgagtgcgaatgcagcgagttccgcttcattgtgaattttctacgctca
cacaagattttactaccagataacttctccaacatagatgtgttagaagcagaagtagaa
attctggaaatccctgagcttacagaagctgtacggttgtaccggatgaatatgggtggc
tgttcccggacctcctgcccacctctaagtcctggaaaggggggtcgtacagccagtgtg
gagtctgtgaaaccactgtacttgatggccctgggcctgctggtcaagtatccagactct
gcactgggacagctgcgcatcgagagcacgctggacggaagcagactatacatcacaggg
aacggggcccttttccagcacgtcaggaactggctgggcacttgtcggctgcccctgact
gagaccatctccgaggtgtatgagctctgcgccttcctggacaagagggacatcacctac
gagccaatgaaagtggctctgaagactcatctggagccaaggactttgctgcccgtggat
gtgctcagtgaggagtggacagctgaggtcacgatatactcaccacagcagatcatcaag
ctttatgttggaagccattggtatgcaacgaccctgcagaccctgatgaagtacccagaa
ctgctatccaacactcagagagtgtactggatcgcctacggacagaccttgctcattcac
ggggacggccaaatgttccgacacattctcaacttcctgagacttggaaaactgttttta
ccatcagaatttaaggaatggcctctcttctgccaggaggtggaggagtatcatattcca
gccctctcagaagccctggcacaatgcgaagcatacaagtcatggactcaggagaaagaa
tctgaaaatgaagaagcttttcccattaggaagctgcatgtggtgaccgaagggacaggg
ccaatggcagagttcagcagagatgccaaggaaaccacagcctgcatgcctgtggacttc
caggaatgcagtgacaggactccatggaacaaggccaaagggaacctgaccaggtccagc
cagatggaagaggctgagcagtatacccggactattcaggtctccctctgcagaaatgcc
aagaggggaggcaatcccagcacatactcacactgctctggtttatgtgccaaccccaga
cattggggaggtcactctgagagtccccccaagaagaagtgcaccactataaacctcaca
cagaaacctgatgccaaagaccctcctgtcacccccatgcaaaaactcatatctttagtc
agggaatgggacatggtcaactgtaaacagtgggaattccagccactgccagcctccagg
agcagctctgtggaggaggctagcctgcatgtcccctcgggaagtgaggctgctccgcag
cctggtacctcagctgcttggaaagctcattccataacctctgagaaggatgctggtccc
cagactggacccggagctggagtgaaagacaagggtccagagccaacctttaagccatac
ttccctacaaaaagagctattaccctaaaggactggggcaagcagaggcccaaggacaga
gaaagccctgctcctgagcagcctctgcctaatgctaacgggaccgacaatccaggggcc
atcctcaaagtggctcacccccctgtggtgggtaatgatggctcctgcatgttctttgaa
gacagcattatctacaccacccaaatggataacatcaagcatacatcactcacagccagc
ccccaacttcgagaagtgacttttctgagcttctctctgtcctgggaggagatgttttat
gcacagaaatgtcaccgcttcctgaccgacatcatcttggattccatcaggcaaaaggat
cccaaagctatcacagccaaggtggtgtctctggcctaccgactgtggacactgaacatc
agccccaagcagttcgtggtggatctgctggccatcgctggcttcaaggatgaccggcac
actcaggagcgtctgtacagttgggtagagctcacactgcctttcgccagaaaatatggc
cgttgcgtggacctgctcatccagaggggactgtccaggtctgtctcttattcagtcctg
ggcaagtatttacacgagggctag

DBGET integrated database retrieval system