KEGG   Mus musculus (mouse): 279561
Entry
279561            CDS       T01002                                 

Gene name
Wnk3, Prkwnk3, Wnk3-ps
Definition
(RefSeq) WNK lysine deficient protein kinase 3
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    279561 (Wnk3)
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    279561 (Wnk3)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     279561 (Wnk3)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: Other
  Wnk family
   279561 (Wnk3)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     279561 (Wnk3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr OSR1_C
Other DBs
NCBI-GeneID: 279561
NCBI-ProteinID: NP_001258607
MGI: 2652875
Ensembl: ENSMUSG00000041245
Vega: OTTMUSG00000019169
UniProt: Q80XP9
Position
X; X F3
AA seq 1757 aa
MATDSGEPASTEDSEKPDGVSFENRAARAVAPLTVEARIKEKYSTFSASGENIERKRFFR
KSVEMTEDDKVAESSRRDERKAATNISRVDKVPTNVLRGGQEVKYEQCSKATSESSKDCF
KEKTEKEMEEEAEMKAVATSPSGRFLKFDIELGRGAFKTVYKGLDTETWVEVAWCELQDR
KLTKAEQQRFKEEAEMLKGLQHPNIVRFYDSWESTLKGKKCIVLVTELMTSGTLKTYLKR
FKVMKPKVLRSWCRQILKGLQFLHTRTPPIIHRDLKCDNIFITGPTGSVKIGDLGLATLM
RTSFAKSVIGTPEFMAPEMYEEHYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRKV
TSGIKPASFNKVTDPEVKEIIEGCIRQNKSERLSIKDLLNHAFFAEDTGLRVELAEEDDC
SNSSLALRLWVEDPKKLKGKHKDNEAIEFSFNLEADTPEEVAYEMVKSGFFHESDSKAVA
KSIRDRVTLIKKIREKKPAGCLEERRDSQCKYVRNVLPQQQTATLQPTPGPHTAAEYEET
EVDQHVRQQFLQGKPQQQSSSVRGDTSSEPTAGPVLHSDTSSHPTVAYSSNQTTSSQEQP
KLTQSPVLPVVQGQSSVMPIYAAGVGVVSQSQISPLTIQKVSQIKPVSQPIGAEQQATLQ
NPDFVRSLNQDVTSVKENTNNPDTPSGNGKQDRNKQRRASCPRPEKGTKFQLTVLQVSVS
GDNMVECQLETHNNKMVTFKFDVDGDAPEDIADYMVEDNFVLENEKEKFVEELRAIVGQA
QEILHVHSAVEKSIGVDSVALESNSNQTGSSEQVLINSASTQTSNESAPQSSPVGRWRFC
INQTIKNREAQSPPSLQPSMAMVPGLHPFPSSRNTSNQAISQNTVFTIENNPGHRELFTS
KLDHKDVVDGKIGEHASIETEQSSISYQVEDDRQIMTPATDNSNYSAALVCPVPGECEAL
TSQAGMFMPTYPNQQAAVLADVHIAYPGESVPIGGNAALTSVLVSSDQKPQSLSVQQPTI
DAEFISKEGETTVNTETSSPKAVIATQTPGFEPAVILPATILESDGERPPKMEFADNRIK
TLDEKLRNLLYQEHSISSICPESQKDTQSIDSPFSSSAEDILSYSMPEVIAISHCGIQDS
PAQSPNFQQTGSKILSNVAASQPAHISVFKKDLNVITSVPSELCLHEMSPDASLPGDPEA
YPAAVSSDGTIHLQTGGGYFGLSFTCPSLKNPISRKSWTRKLKSWAYRLRQSTSFFKRSK
VRQVETEDKRSAIASDPIPLTREFSSDTRALSRCKAMSGSFQRGRFQVITVPQQQPVKMM
SFGKDHRPPFNKTTVQSSEQALTFAEAAVSQLIEVEPAMPTHKASVSSRKLRTLYETFKE
DKGDPEQGDIVSYSTACETSVSSVATEKNVTSTTEVSVQSGSEPLDKEKNESTPGKQTCT
NEFSATLAGNRKSVTKTRPEGDQYLPLREEQAYAQTQNSLFYSPSSPMSSDNESEIEDED
LKVELQRLREKHIQEVVSLQTQQNKELQELYERLRATKDNKAQSSEVPLSPASPRRPRSF
KSKLRSRPQSMTHSDNLVVKDALGVESNTVSCQQSPASKKGMFTDDLHKLVDDWTRETVG
HFPSKPSLNQLKQSQQKSEAENWNKSCESTPSTMGYTSNWISSLSQIRGAAPTSLPQGLP
LPSFHGPLASYGMPHVCQYNAVGAAGYPVQWVGISGPAQQSVVLPTQSGGLFQPGMNLQS
FPAPPVQNPASIPPGPK
NT seq 5274 nt   +upstreamnt  +downstreamnt
atggccactgattctggggagccagctagcacagaagattctgagaagcctgatggagtt
tcctttgaaaacagggctgcccgggctgttgcccctctgactgtagaagcgagaataaag
gaaaaatacagtaccttttctgcttccggggaaaacatcgaaagaaagaggtttttccga
aagagtgttgagatgacagaagatgacaaagttgccgaatcttcccgcagagatgaaaga
aaagctgcaacaaatatttcaagagtagataaagttcctacaaatgtgctaagaggtggg
caagaagttaaatatgagcaatgttcaaaggcaacctcagaatcctcaaaagattgcttc
aaggagaaaactgaaaaggaaatggaagaagaagcagaaatgaaggctgttgcaacttcc
cctagtggcaggttcctgaaattcgatatagagctgggaagaggagcatttaaaacggta
tataaaggattggacactgagacatgggttgaagttgcttggtgtgagctacaggaccgc
aaattaactaaagctgagcagcaacggttcaaagaagaagcagagatgttgaaaggcctc
cagcatcccaatatagttcgattctatgattcatgggagtccactttgaaaggaaagaaa
tgtattgtgttagtgactgaactaatgacatcaggaaccttaaagacgtacttaaaacga
tttaaagtcatgaaaccaaaggtcttaagaagctggtgcaggcaaatcttaaaaggattg
cagttcttacacacaaggacgcctcctattattcaccgggatctgaaatgtgacaacatt
ttcatcacaggacccactggatctgtgaagattggtgatctgggacttgcaaccttaatg
cgcacatcgtttgctaagagtgtcattggcactcctgaatttatggctccggagatgtat
gaagaacactatgatgaatctgtagatgtttatgcttttggaatgtgtatgttggaaatg
gctacttcggagtatccatattctgagtgccagaatgcagcacaaatataccggaaagta
accagtggcataaaaccagccagcttcaataaagtcacagaccctgaagtgaaagaaata
attgaaggatgtattagacaaaacaaatctgaaaggttatctatcaaggacttactaaac
catgcattctttgctgaggatactggactgagggtggagttagcagaggaagatgattgc
tcaaattcatccttggctctaagactctgggttgaagatcctaagaaattaaaaggcaaa
cataaagacaatgaagctattgaattcagtttcaacttagaagcagatacacctgaggaa
gtagcgtatgaaatggtcaagtctggattcttccatgaaagtgattccaaagctgttgct
aagtccattagggaccgagtgacattgattaaaaagataagggaaaaaaagcctgctgga
tgcttggaggaacgcagggattcccagtgcaagtatgtgaggaatgtacttcctcaacag
cagactgcaactttacaacctactcctggtccacacactgcagctgagtatgaagaaaca
gaagttgatcaacatgttcgacagcagtttctacagggcaaaccacagcagcagtcctcc
tctgttaggggtgacacttcatctgagccaacagctggaccagttctacattcagatact
tcaagtcatcccactgtagcctattcttcaaaccagacaactagctctcaggagcagcca
aagctgactcagtccccagttttgcctgtggttcaaggtcagtcctctgttatgcccata
tatgctgctggagttggagttgtttcacagtcccaaatctctcccttaactatccagaag
gtctcacagataaagcctgtatcccaaccaattggagctgaacaacaagcaactcttcaa
aatccagattttgttcgaagcttgaatcaagatgtgacatctgtgaaagaaaacaccaat
aaccctgataccccaagtggaaatggcaaacaggatcggaacaaacaacgaagagcctcc
tgtccccgaccagagaaggggactaaattccagcttactgtccttcaggtctcagtctct
ggagacaacatggtggagtgtcagctggaaacacataacaacaagatggtgacattcaag
tttgatgttgatggtgacgcacctgaggatatcgctgactatatggttgaagataacttt
gtgctggaaaatgagaaagaaaaatttgtcgaggaattgagggctatcgtaggtcaagcc
caggagatccttcatgtccactcagctgtagaaaaatctattggtgttgactctgttgcc
ttggaatctaacagtaaccaaacaggatcatctgaacaagtactgataaattctgcatcc
actcaaactagcaatgaatctgctcctcagtcatccccagttggtcgctggcggttttgt
atcaaccaaacaataaaaaaccgtgaggcacagtctcctccttcccttcagccttccatg
gccatggtgcctgggttacatccatttcctagttcaagaaacacaagtaatcaggcaata
tcacagaacacagtgttcactatagagaataatccaggccatcgtgaacttttcacctcc
aaattagaccacaaggatgtggttgatggtaagattggtgaacatgctagtatagaaact
gagcagtcaagtatttcctatcaagtggaagatgacagacagatcatgacaccagctact
gataattccaattattctgctgctttggtgtgtccagttccaggtgaatgtgaggcactc
accagccaagcaggcatgttcatgcctacatatccaaatcagcaagctgctgttctggct
gatgtgcatatagcctatcccggtgaatcagttccaattggtggtaatgctgctcttaca
tcagtacttgtatcttctgatcaaaagcctcaatccttgtcagtacagcagccaactata
gatgcagagtttatttccaaagaaggagaaaccacagtaaacaccgaaacaagttctcct
aaggcagtcattgccactcagactcctggctttgaaccagctgtgattctacctgctact
atcctggaatcagatggggaacgacctccaaaaatggagtttgcagacaaccgaattaaa
acactggatgaaaaattaagaaacctgctctatcaggagcacagcatttctagcatctgt
cctgagagtcagaaggatactcaaagcatagactctccattttcttcctctgctgaagat
atactatcctattcaatgccagaagtcatagccatcagtcactgtgggattcaagatagc
cctgcacaatccccaaatttccaacaaacaggctctaagattctgtccaatgtggctgca
agtcagcctgctcatatatcagtgttcaaaaaagacctgaatgtgataacttctgtaccc
agcgagttatgtttacatgagatgtccccagatgcttcacttccaggcgatccagaggcc
tatcctgctgctgtgtcaagcgatggaaccattcatctgcagacaggaggtggatatttt
ggcctaagctttacttgtcctagtctcaaaaatcctattagcaggaaatcctggactcga
aaattaaaaagctgggcatacaggctacggcagtcaaccagctttttcaagagatcaaaa
gtccgtcaagtggaaacagaagataaaagatcagcaattgcttctgatcccattcctctg
acacgggagttctcatctgatactagggctttgagtagatgtaaagcgatgagtggatca
tttcagcggggtcggttccaggtgattactgttcctcagcagcagccagtaaaaatgatg
tcttttgggaaagatcacagaccgccattcaacaaaacaacagtccagtctagtgagcaa
gcactaacctttgctgaagctgcagtgtcgcagttgatcgaagtggagcctgccatgccc
actcataaagcttcagtttcttcacgcaagttgcgaactctttatgaaacctttaaagaa
gataaaggagatcctgaacaaggtgacatcgtatcttacagcacagcttgtgagaccagt
gtctcttcagtcgctacagaaaagaatgtaacttcaaccacagaagttagtgtgcagtct
gggtctgaaccgttagataaagaaaaaaatgagtcaactcctgggaaacagacatgtaca
aatgaattttcagccactcttgctggtaatagaaagtccgtgacaaaaactcgtccagag
ggtgatcagtatttaccactccgtgaagagcaagcctatgctcaaacacagaattcactc
ttctattctccatcttccccaatgagcagtgacaatgaatcagaaattgaggacgaggac
ttgaaagtggagcttcaaagattacgagaaaaacacattcaagaggtggtcagtcttcaa
acacaacagaataaagagctacaagagctctatgaacgccttcgagcaactaaagacaac
aaagcgcaatcttcagaggttcctttgtcacctgcatcgccacgcaggccaagatctttc
aaaagcaaacttcgaagccgcccccagtccatgacacattcagacaatctcgttgtaaaa
gatgcactgggtgtggagagtaataccgtgtcatgccagcaatctccagccagtaagaag
gggatgttcacagatgatttacacaagctggtggatgactggacaagagaaacagtaggg
cattttcctagtaagccaagtttaaaccaactcaaacagagccaacaaaaatccgaagca
gaaaactggaacaagtcatgtgaaagtactccatctactatgggatacacgtcaaactgg
atttcttctctctcccaaattcgtggagctgccccaacttccttgccacaaggactccca
ctcccttcatttcatgggccattagcatcatatggaatgcctcacgtttgtcagtataat
gctgtgggtgccgcaggttatccagtacagtgggtaggaatttctggaccagcacaacag
tctgtagtgcttcctacccaatctgggggactcttccagcccgggatgaatttgcagtca
tttccagctccaccagtgcagaatccagcttcaatccctcctggtcctaaatga

DBGET integrated database retrieval system