KEGG   Mus musculus (mouse): 279572
Entry
279572            CDS       T01002                                 

Symbol
Tlr13, AI666735, Gm713
Name
(RefSeq) toll-like receptor 13
  KO
K18808  toll-like receptor 13
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:mmu04054]
    279572 (Tlr13)
Pattern recognition receptors [BR:mmu04054]
 Membrane-bound pattern recognition receptors
  Toll-like receptors
   279572 (Tlr13)
SSDB
Motif
Pfam: LRR_8 LRR_4 LRR_5 TIR TIR_2 LRR_9 LRR_1 LRR_6 DUF1863
Other DBs
NCBI-GeneID: 279572
NCBI-ProteinID: NP_991389
MGI: 3045213
Ensembl: ENSMUSG00000033777
Vega: OTTMUSG00000018275
UniProt: Q6R5N8
Structure
PDB: 
4Z0C

Position
X; X D
AA seq 991 aa
MSGLYRILVQLEQSPYVKTVPLNMRRDFFFLVVTWMPKTVKMNGSSFVPSLQLLLMLVGF
SLPPVAETYGFNKCTQYEFDIHHVLCIRKKITNLTEAISDIPRYTTHLNLTHNEIQVLPP
WSFTNLSALVDLRLEWNSIWKIDEGAFRGLENLTLLNLVENKIQSVNNSFEGLSSLKTLL
LSHNQITHIHKDAFTPLIKLKYLSLSRNNISDFSGILEAVQHLPCLERLDLTNNSIMYLD
HSPRSLVSLTHLSFEGNKLRELNFSALSLPNLTNLSASRNGNKVIQNVYLKTLPQLKSLN
LSGTVIKLENLSAKHLQNLRAMDLSNWELRHGHLDMKTVCHLLGNLPKLETLVFQKNVTN
AEGIKQLAKCTRLLFLDLGQNSDLIYLNDSEFNALPSLQKLNLNKCQLSFINNRTWSSLQ
NLTSLDLSHNKFKSFPDFAFSPLKHLEFLSLSRNPITELNNLAFSGLFALKELNLAACWI
VTIDRYSFTQFPNLEVLDLGDNNIRTLNHGTFRPLKKLQSLILSHNCLKILEPNSFSGLT
NLRSLDLMYNSLSYFHEHLFSGLEKLLILKLGFNKITYETTRTLQYPPFIKLKSLKQLNL
EGQRHGIQVVPSNFFQGLGSLQELLLGKNPSVFLDHHQFDPLINLTKLDISGTKDGDRSL
YLNASLFQNLKRLKILRLENNNLESLVPDMFSSLQSLQVFSLRFNNLKVINQSHLKNLKS
LMFFDVYGNKLQCTCDNLWFKNWSMNTEEVHIPFLRSYPCQQPGSQSLLIDFDDAMCNFD
LGKVYFLCSFSMVLSTMVFSWFSTKMIASLWYGLYICRAWYLTKWHKTEKKFLYDAFVSF
SATDEAWVYKELVPALEQGSQTTFKLCLHQRDFEPGIDIFENIQNAINTSRKTLCVVSNH
YLHSEWCRLEVQLASMKMFYEHKDVIILIFLEEIPNYKLSSYHRLRKLINKQTFITWPDS
VHQQPLFWARIRNALGKETVEKENTHLIVVE
NT seq 2976 nt   +upstreamnt  +downstreamnt
atgagtgggctctacaggatcctggtccagctggaacaaagtccatatgtgaagaccgtg
cctttgaacatgagaagggatttttttttcctggttgtaacctggatgcctaagacagtc
aagatgaatgggagcagctttgtgccatctctacagctcctgctcatgttagtaggattt
tctctgccgcctgtggcagagacatatgggttcaacaagtgcacacagtatgaatttgat
attcaccatgtgctctgcattaggaagaagatcaccaacttgacagaggccattagtgac
atacctagatatactactcaccttaacctcacacacaacgaaattcaagtcctccctccc
tggagttttaccaatctgtctgctctggtggacttgagactagagtggaactcaatttgg
aagatcgacgaaggtgcctttaggggacttgaaaatttgactctgctgaatttagtggaa
aataagattcaaagtgtgaataactcctttgagggcctgtccagcctgaagaccctgctc
ctgagccataatcagattacccatattcacaaagacgccttcactcctctaatcaaattg
aaatatttgagcctatctcgaaacaacattagcgatttttctggtattcttgaagcagtc
cagcatcttccatgcctggagcgccttgatctaactaacaacagcatcatgtacttggac
cacagccctaggtcactggtttctctgacccacctgagttttgaggggaacaaactaagg
gagttaaacttctctgctttgtcattacctaacttaaccaatctaagtgcttcccggaat
ggcaataaagtcattcagaatgtgtatcttaaaactctgccccaacttaaaagcttgaat
ctgagtggaacggtgataaaattggaaaatctttcggccaaacacctgcagaatctaaga
gctatggatctcagtaattgggagcttagacatggtcacttagatatgaaaactgtttgt
cacctgctcggaaacctacccaagttagagacactggtttttcagaaaaatgtcaccaat
gcagagggcattaagcagctggcaaagtgcaccaggctcttgttccttgacctgggtcaa
aacagtgacttgatttatctcaatgacagcgagttcaatgctctgcccagtctccaaaaa
ctgaatttgaacaagtgccagctctccttcatcaacaacaggacctggagttccttgcag
aacttgaccagcctagatctgagccacaacaagtttaaaagctttccagattttgcattt
tcccccttgaagcacttggagtttctctctctttcaagaaaccccatcacagaactcaat
aatctggcctttagtgggctatttgcactgaaggagctcaacttggctgcatgttggatt
gtaacaattgacaggtattcctttactcagtttccaaacttagaggtcttagatcttgga
gacaacaatattcggactctcaaccacggaaccttccgacctctgaaaaaactccagtct
ttgattctttcccacaactgcctaaaaatcctggagccaaattcgttttctggtctcact
aacctacgttcccttgacctgatgtacaacagcttgtcatattttcatgaacaccttttc
tcgggccttgaaaagcttctgattttgaaacttggttttaataagatcacatatgaaact
actaggacccttcagtatcctccatttataaagctcaagtctttgaaacagcttaaccta
gaaggacaaagacacgggattcaggttgttccgagcaactttttccaaggattgggtagt
ttgcaggagttactcttaggaaaaaatccctctgtattcctggaccaccaccaatttgac
cctctgattaacctcacaaagttggatatctcaggaacaaaagatggagatcgaagcctc
tatttaaatgcttccttattccaaaacctcaaaaggctaaagatcctccgccttgaaaat
aacaacttagagtcactggttcctgacatgttctccagcttacagagcctccaggtcttt
tctttaagattcaacaacttgaaggtcattaatcaaagtcatctgaagaatctgaaatca
ctgatgttttttgatgtctatgggaacaaacttcagtgcacctgtgacaatttgtggttc
aagaactggtcaatgaacacagaggaggtccacatccccttcctccggagctatccctgt
cagcagccaggcagccagagtttacttatagattttgatgatgccatgtgtaattttgac
ttgggaaaggtctacttcttatgttccttcagtatggtcctcagcaccatggtcttctct
tggttcagtaccaagatgattgcatctctgtggtatggtttgtacatatgtagggcctgg
tacctcactaaatggcacaaaacggagaagaagttcttatatgatgcgtttgtctctttc
tcggccactgatgaggcatgggtatacaaagagcttgttccagccctagaacaaggcagc
cagaccacctttaaactctgtcttcaccaacgggattttgaaccaggcattgatatcttc
gagaacatccagaatgctattaacacaagcaggaaaaccttgtgcgtagtcagtaaccac
tacctacacagtgaatggtgccgacttgaagtccagctggctagcatgaagatgttttat
gagcacaaggatgtcattatcttgatcttccttgaagagattccgaactataagctgtcc
agctaccaccgactcaggaaactcataaacaaacagacgtttatcacttggccggacagt
gttcaccagcagccacttttctgggctcgcatcagaaatgcgttgggcaaggagactgtg
gagaaagaaaatacacatctaattgttgttgagtga

DBGET integrated database retrieval system