KEGG   Mus musculus (house mouse): 279653
Entry
279653            CDS       T01002                                 
Symbol
Pcdh19, B530002L05Rik, Gm717, mKIAA1313
Name
(RefSeq) protocadherin 19
  KO
K16499  protocadherin delta 2
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mmu04515]
    279653 (Pcdh19)
Cell adhesion molecules [BR:mmu04515]
 Cadherins
  Protocadherins
   279653 (Pcdh19)
SSDB
Motif
Pfam: Cadherin Cadherin_2 Cadherin_C_2 Plug
Other DBs
NCBI-GeneID: 279653
NCBI-ProteinID: NP_001098715
MGI: 2685563
Ensembl: ENSMUSG00000051323
UniProt: Q80TF3
Position
X:complement(132483609..132589802)
AA seq 1145 aa
MESLLLPVLLLLAVLWTQAAALINLKYSVEEEQRAGTVIANVAKDAREAGFALDPRQASA
FRVVSNSAPHLVDINPSSGLLVTKQKIDRDLLCRQSPKCIISLEVMSSSMEICVIKVEIK
DLNDNAPSFPAAQIELEISEAASPGTRIPLDSAYDPDSGSFGVQTYELTPNELFGLEIKT
RGDGSRFAELVVEKSLDRETQSHYSFRITALDGGDPPHMGTVGLSIKVTDSNDNNPVFGE
STYSVSVPENSPPNTPVIRLNASDPDEGTNGQVVYSFYGYVNDRTRELFQIDPHSGLVTV
TGALDYEEGHVYELDVQAKDLGPNSIPAHCKVTVSVLDTNDNPPIINLLSVNSELVEVSE
SAPPGYVIALVRVSDRDSGLNGRVQCRLLGNVPFRLQEYESFSTILVDGRLDREQHDQYN
LTIQARDSGVPMLQSAKSFTVRITDENDNHPHFSKPYYQVIVQENNTPGAYLLSVSARDP
DMGLNGSVSYQIVPSQVRDMPVFTYVSINPNSGDIYALRSFNHEQTKAFEFKVLAKDGGL
PSLQSNATVRVIILDVNDNTPVITAPPLINGTAEVYIPRNSGIGYLVTVVKADDYDEGEN
GRVTYDMTEGDRGFFEIDQVNGEVRTTRTFNENSKPSYELIVVAHDHGKTSLSASALVLI
YLSPALDAQESMGSVNLSLIFIIALGSIAGILFVTMIFVAIKCKRDNKEIRTYNCSNCLT
ITCLLGCFIKGQNSKCLHCISVSPNSEEQDKKAEEKVSLRGKRIAEYSYGHQKKSSKKKK
ISKNDIRLVPRDVEETDKMNVVSCSSLTSSLNYFDYHQQTLPLGCRRSESTFLNVENQNT
RNTTASHIYHHSFNSQGPQQPDLIINGVPLPETENYSFDSNYVNSRAHLIKSSSTFKDLE
GNSLKDSGHEESDQTDSEHDVQRSLYCDTAVNDVLNTSVTSMGSQMPDHDQNEGFHCREE
CRILGHSDRCWMPRNPMPTRSKSPEHVRNIIALSIEATAADVEAYDDCGPTKRTFATFGK
DVSSHRAEERPILKGKRTVDVTICSPKVNSAIREAGNGCEAISPVTSPLHLKSPLPTKPS
ISYTVALAPPAHDLEHHANSGASRPSEAEPRGADNEKVMHEVNPIRKDGRDKESPSVKRL
KDIVL
NT seq 3438 nt   +upstreamnt  +downstreamnt
atggagtctctcctgctgccggtgctattgctgctggctgtactgtggacgcaggcggct
gccctgattaaccttaaatactcggtcgaagaggagcagcgcgccgggacggtgatcgct
aacgtggccaaggacgcgcgggaggccggcttcgcgctggacccccgacaggcttctgct
ttccgcgtggtgtccaactcggctccgcacctggtggacatcaaccccagctcgggcctc
ttggtcaccaagcagaagattgaccgagacctgctgtgccgccagagccccaagtgtatc
atctcgctcgaggtcatgtccagctcaatggagatctgtgtgattaaggtggagatcaaa
gacctgaacgacaatgctcccagttttccggccgcacagatagagctggagatctctgag
gcagccagccccggcacccgcatcccactggacagtgcatatgacccggactccggcagc
tttggtgtgcagacctacgagctcacgcccaacgagctgtttggcctggaaataaagacg
cggggtgacggttcgcgctttgctgaactggtggtggagaagagcctggaccgtgagaca
cagtcacattacagctttcgcattacggctctcgacggaggcgacccaccacacatgggc
acagttggcctcagcatcaaggtgaccgattcgaatgacaacaacccagtgtttggcgag
tccacctactcagtgagcgtgcctgaaaattcacctcccaatacacccgtcatccgcctc
aatgccagcgatccagatgagggcaccaatggccaagtggtctattccttctatggttat
gtcaatgaccgtacgcgtgaactcttccaaattgacccacacagcggcctggtcaccgtc
accggtgcgctagactatgaagagggccatgtgtacgaactggatgtgcaagccaaagac
ctggggcccaactctatccctgcacactgcaaagtcacagtcagcgtacttgatactaat
gacaacccgccaattatcaacctcctgtcggtcaatagcgagcttgtggaggtgagcgag
agcgcccccccgggctatgtgattgccctggttcgggtgtctgatcgcgactccgggctc
aatggacgtgtgcagtgccgcttgctgggcaatgtcccctttcgactgcaggagtatgag
agcttctccactattcttgtggatgggaggctggaccgagagcagcatgaccagtacaat
ctcactattcaggctcgagacagcggtgtgcctatgctgcagagtgccaagtcgttcact
gtgcgtatcacagatgagaatgacaaccacccacacttctccaagccttactaccaagtc
attgtacaggagaacaacactcctggtgcctatctgctctcagtgtctgcccgcgaccct
gacatgggtcttaatggcagtgtctcctatcaaattgtgccatcacaggtgcgagacatg
ccagtcttcacctatgtctcaatcaatcccaactctggtgacatctatgcgctccgttcc
tttaaccatgagcagaccaaggcgtttgaattcaaggtcctggccaaggatggcggcttg
ccctccctgcaaagcaatgccactgtgagggtcattatcctcgacgtcaatgacaataca
ccggtcatcactgccccacctctgatcaatggcactgctgaggtctacattcctcgaaac
tctggcataggctatttggtgactgtagttaaggcagacgattatgatgagggcgaaaat
ggccgagtcacctatgacatgacagaaggtgaccgaggtttcttcgaaatagaccaggtc
aatggagaagtcagaaccactcgtacctttaatgagaactccaagccttcctatgagctt
atagtggtggcccatgaccatggcaagacatctctctctgcttctgcccttgtcctaata
tacctgtccccagctcttgatgcccaagagtcaatgggctctgtgaacttatccctgatt
ttcattattgctctgggctccattgcgggcattctctttgtcactatgatcttcgtggca
atcaaatgcaagcgtgacaacaaagagatccggacctacaattgcagtaattgtttaacc
atcacttgtctcctcggctgttttataaaaggacaaaacagcaagtgtctgcattgcatc
tcggtttctcccaatagtgaggagcaagacaaaaaggcagaggagaaagtgagcctaagg
ggaaagagaatcgctgagtactcctatgggcatcaaaagaaatcaagtaagaagaaaaaa
attagtaagaatgacatccgccttgtacctcgggacgtggaggagacagacaagatgaat
gttgtcagttgctcctcccttacttcgtccctcaactatttcgactaccaccagcagaca
ctgcccctgggctgtcgtcgctctgagagcactttcctgaatgtggagaaccagaatacc
cgtaacaccactgccagccacatctaccatcactccttcaacagccagggcccacagcag
ccagacctgatcatcaatggtgtgcccctgcctgagactgaaaactattcttttgactct
aactacgtgaatagccgtgcccatttaatcaaaagcagctccaccttcaaggacctagag
ggcaacagcctgaaggatagtgggcatgaggagagtgaccagactgacagtgagcatgat
gtccagaggagcctgtactgcgatactgctgtgaatgatgtcctgaacaccagtgtgact
tccatgggatctcagatgcctgaccatgaccagaatgaaggatttcattgcagggaagaa
tgccggattcttggccactctgatagatgctggatgcctcggaatcccatgcccacccgc
tccaagtcacctgagcacgtgaggaacatcatcgctctgtccattgaagctactgctgct
gatgttgaggcttatgacgactgcggccccaccaagcggactttcgcgacctttggaaaa
gatgtcagtagccaccgggctgaggagcgtcccatcctgaaaggcaagcggactgtcgat
gtgaccatctgcagccccaaagtcaacagcgctatccgggaggcaggcaatgggtgtgaa
gctattagccctgtcacctccccactccacctgaagagccctctgcccaccaagccttct
atatcttacaccgtcgccctggctcctccagctcacgatctggagcaccatgccaacagt
ggcgcctctcgtccttctgaggctgagccccgtggagccgacaacgagaaagtgatgcat
gaggtcaaccctattcggaaggatggtcgtgacaaggaatctcctagcgtgaagcgtctg
aaggatatcgttctctaa

DBGET integrated database retrieval system