KEGG   Mus musculus (mouse): 27967Help
Entry
27967             CDS       T01002                                 

Gene name
Cherp, 5730408I11Rik, D8Wsu96e, DAN16, Scaf6
Definition
(RefSeq) calcium homeostasis endoplasmic reticulum protein
  KO
K12841  calcium homeostasis endoplasmic reticulum protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    27967 (Cherp)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mmu03041]
    27967 (Cherp)
Spliceosome [BR:mmu03041]
 Complex A
  U2 snRNP components
   U2 related factors
    27967 (Cherp)
 Complex B
    27967 (Cherp)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CTD_bind Surp G-patch SEN1_N
Motif
Other DBs
NCBI-GeneID: 27967
NCBI-ProteinID: NP_613051
MGI: 106417
Ensembl: ENSMUSG00000052488
Vega: OTTMUSG00000062111
UniProt: Q8CGZ0 A0A1D5RL92
Position
8 B3.3; 8 35.08 cM
AA seq 938 aa AA seqDB search
MEMPMPPDDQELRNVIDKLAQFVARNGPEFEKMTMEKQKDNPKFSFLFGGEFYSYYKCKL
ALEQQQLICKQQAPELEPTSAMPPLPQPPLAPTASLTPAQGTPSMDELIQQSQWSLQQQE
QHLLALRQEQVTTAVAHAVEQQMQKLLEETQLDMSEFDNLLQPIIDTCTKDAISAGKNWM
FSNAKSPPHCELMAGHLRNRITADGAHFELRLHLIYLINDVLHHCQRKQARELLAALQKV
VVPIYCTSFLAVEEDKQQKIARLLQLWEKNGYFDDSIIQQLQSPALGLGQYQATLINEYS
SVVQPVQLAFQQQIQSLKTQHEEFVSSLAQQQQQQQQQQQQQPQPQPQPQIQLPQMEADV
KATPPPPAPPPASAPAPTIPPTTQPDDNKPPIQMPGSSEYDTSAGVQDPAAAGPRGPGPH
EQIPPNKPPWFDQPHPVAPWGQQQPPEQPPYPHHQGGPPHCPPWNNSHEGMWGEQRGDPG
WNGQRDAPWNNQPDPNWNNQFEGPWNNQHEPPPWGGAQREPPFRMQRPPHFRGPFPPHQQ
HPQFNQPPHPHNFNRFPPRFMQDDFPPRHPFERPPYPHRFDYPQGDFPADMGPPHHHPGH
RMPHPGINEHPPWAGPQHPDFGPPPHGFNGQPPHMRRQGPPHINHDDPSLVPNVPYFDLP
AGLMAPLVKLEDHEYKPLDPKDIRLPPPMPPSERLLAAVEAFYSPPSHDRPRNSEGWEQN
GLYEFFRAKMRARRRKGQEKRNSGPSRSRSRSKSRGRSSSRSSSRSSKSSRSSSRSHSRS
RSRSSSRSRSRSRSRSRSSRSRSRSRSRSRSRSKSYSPGRRRRSRSRSPTPPSAAGLGSN
SAPPIPDSRLGEENKGHQMLVKMGWSGSGGLGAKEQGIQDPIKGGDVRDKWDQYKGVGVA
LDDPYENYRRNKSYSFIARMKARDEFSTFGTRKEEKED
NT seq 2817 nt NT seq  +upstreamnt  +downstreamnt
atggagatgccgatgccgccagatgatcaggagcttcgaaatgtcatcgataagctcgct
cagtttgtggctcgcaacggacccgagttcgagaaaatgacgatggagaagcagaaggac
aaccctaagttctcgtttctgtttggaggcgagttctacagttactacaagtgcaagctg
gcactggagcagcaacagctaatctgcaagcagcaggccccagagctggagcccacctca
gccatgccccctctgccacaacctccgctggctcccacagcgtccctcactccggcccag
ggcaccccatcaatggacgagctcatccaacagagccagtggagtctccagcagcaggaa
cagcacctgctggccctgcgccaggagcaagtaacgacagccgtggcacatgcagtggaa
cagcaaatgcagaagctgctggaagagacacaactggacatgagcgagtttgacaacctg
ctacagcccatcattgacacctgcacaaaggatgccatctcggctgggaagaactggatg
ttcagcaatgctaagtccccaccacactgtgagctgatggcaggccacctgcgcaaccgc
atcactgctgatggcgcacacttcgagctgcggctacacctcatctatctgatcaatgac
gtgctgcaccactgccagcgcaagcaggcccgggagctgctggctgccttgcagaaggtg
gtagtacccatctattgcaccagcttcctggctgtggaggaggacaaacagcagaagatt
gcccggctcctgcagctctgggaaaagaacggctactttgatgactccatcattcagcaa
ctgcagagccctgccctgggacttggtcagtatcaggcgactctcatcaatgagtactcg
tcagtggtgcagcctgtgcagctggccttccagcagcagatccagagcctcaagacacag
catgaagagttcgtcagcagcttagcccagcagcagcagcagcagcaacaacagcagcag
cagcagccgcagccacagccacagccacagattcagctgcctcagatggaagcagatgtg
aaggccacacccccaccaccagcaccaccaccagcctcagcacctgcccccaccatccca
ccaactacccagccagatgacaacaagcctcccatccagatgcctggctcttcagagtac
gacacctctgcaggtgtccaggatcctgcagctgctggccctcgaggtcctggcccccat
gagcagatcccgccaaacaagcccccttggtttgatcagcctcacccagttgccccttgg
ggtcaacagcagccccctgagcaacccccatacccacaccaccaaggtggaccaccccat
tgcccaccctggaacaacagccacgagggcatgtggggtgagcagcgaggggaccctggc
tggaatgggcagcgagatgctccgtggaacaaccagccagatcccaattggaataaccag
tttgaaggaccatggaacaatcagcatgagccaccgccctggggtggtgcccagcgggag
ccgcccttcagaatgcagcggcccccccacttccgtgggccgttcccaccccaccagcag
cacccacagttcaaccagcctccacatccccacaacttcaaccggttcccaccccgcttc
atgcaggatgacttcccacctcgtcacccttttgagcggccaccctaccctcaccgcttt
gactatccccagggagactttcctgcagacatgggaccccctcatcaccaccctggccac
cgaatgccacaccctgggatcaatgagcacccaccttgggctgggccccagcaccctgac
tttggccctcctccccacggcttcaatggccagcctccccacatgcggcgacagggccca
cctcacatcaaccatgatgaccccagcctagtccccaatgtgccctacttcgatcttcca
gcggggttaatggccccccttgtgaagctggaggatcatgagtacaagcctctggacccc
aaagacatccgcctgccaccccccatgcctcccagtgagaggctactcgcagctgtggag
gccttctacagtccgccctcccatgacaggccaaggaacagtgagggctgggagcagaat
ggcctctatgagttctttcgagccaagatgcgagcacggcggcgcaagggccaggagaag
agaaacagcggcccctccagatcacgcagccggtccaaaagccgaggccgctcctcatct
cgctccagctcccgatcctccaagtcctcacgttcctcctcccgctcacattcccggtct
cggtcccgctcctcctctcgctccaggtccagaagccgcagccggtcacgttcctccaga
agccgctcgcgctccaggtccaggtccaggtccaggtccaagtcatactcccctgggagg
cggcgacgctccaggtcccggagccccaccccaccctctgcagctggcctgggttctaat
tcagcgcctcccataccagactcgaggcttggagaagagaataaaggccatcaaatgctg
gtgaagatgggctggagcgggtctggtggccttggtgcaaaggaacagggcattcaggat
cccattaagggtggtgacgtccgggataaatgggaccagtacaagggcgtgggtgtggcc
ctggacgacccttatgagaactaccgccgcaacaagagctactccttcattgcccgcatg
aaagcccgagatgagttttccacatttgggactcgaaaagaagagaaggaagactga

DBGET integrated database retrieval system