KEGG   Mus musculus (mouse): 27981Help
Entry
27981             CDS       T01002                                 

Gene name
Rsrp1, 2700043I21Rik, D4Ucla2, D4Wsu53e
Definition
(RefSeq) arginine/serine rich protein 1
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: RSRP
Motif
Other DBs
NCBI-GeneID: 27981
NCBI-ProteinID: NP_076154
MGI: 106498
Ensembl: ENSMUSG00000037266
Vega: OTTMUSG00000011095
UniProt: Q3UC65
Position
4 D3; 4 67.15 cM
AA seq 298 aa AA seqDB search
MSSAAMSKYVNDMWPGSPQEKASPSTSGSGRSSRLSSRSRSRSSSRSSRRDSRSSSRSSS
RSHSRPRRSRRSRSRSRRRHQRKYRRYSRSYSRSRSRSRSHRYHRDSRYERPRRYYKSPS
PYRSRSRSRSRGRSQHRWSYYAITRGRRYYGFGRTVYPEDRPRWRERSRTRSRSRSRTPF
RLSEKDRMELLEIAKANAAKALGTANFDLPASLRAKEASQGTAVSSSGPKVEHSEKQTED
ATKNTSEKSSTQRNIAFSSNNSVAKPLQKTTKAAVEEKSSGSPKIDKKKSPYGLWIPV
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcggccgccatgtctaaatacgtgaacgacatgtggcccggctctccgcaggag
aaagcctcgccgtccacctcgggctcgggccgctccagccgcctgtcgtcgcgctcccgc
agccgctcttcgtcccgcagctcccgacgcgactcccgcagctctagccgctcgtcctcg
cgcagccacagccggccgcggaggagcagacggtcccgatcccggtcccgcaggcgccac
cagcgcaagtacaggcgctactcacgctcgtactcacgcagccggtcgcgctcccgcagc
caccgctatcaccgcgacagccgttacgagcggccgcggaggtactacaagtcgccgtcg
ccctaccgctcccggagcaggtcgcgctcccgcgggaggtcgcagcaccggtggtcgtac
tacgcgatcactagagggcggcgctactacggcttcggccggacggtgtaccccgaggat
cgccccaggtggagggaaagatccagaaccaggtcgcgcagcaggagtagaaccccattt
cgcctgagtgagaaagatcgaatggagctactagaaatagcaaaagccaacgcagcaaaa
gctctgggaacagccaacttcgacttgccagcaagtctccgagccaaggaggcaagccag
gggacagctgtttccagcagtgggccaaaggtggagcattcagaaaagcagactgaagat
gcaactaaaaataccagtgaaaagtcttctacacaaagaaacatagccttcagctccaat
aattccgtagcaaagccactgcagaaaacaactaaagctgctgttgaagagaagtcttca
ggatcaccaaaaatagataagaaaaaaagtccttacggactgtggatacctgtctaa

DBGET integrated database retrieval system