KEGG   Mus musculus (mouse): 28015Help
Entry
28015             CDS       T01002                                 

Gene name
Polr2m, AA407243, AA408799, AI303746, AW553238, D9Wsu138e, Grinl1a, mKIAA4185
Definition
(RefSeq) polymerase (RNA) II (DNA directed) polypeptide M
  KO
K21987  DNA-directed RNA polymerase II subunit GRINL1A
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mmu03021]
    28015 (Polr2m)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol II specific subunits
     28015 (Polr2m)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GCOM2
Motif
Other DBs
NCBI-GeneID: 28015
NCBI-ProteinID: NP_848717
MGI: 107282
Ensembl: ENSMUSG00000032199
Vega: OTTMUSG00000036049
UniProt: Q6P6I6
Position
9 D; 9 39.85 cM
AA seq 366 aa AA seqDB search
MFSLPRGFEPPAPEDLGRQSSAELRERLRRQERLLRNEKFICKLPDKGKKISDTVAKLKA
AISEREEVRGRSELFHPVSVDCKLRQKATTRADTDVDKAQSSDLMLDTSSLDPDCSSIDI
KSSKSTSETQGPTHLTHRGNEETLEAGYTVNSSPAAHIRARAPSSEVKEHLPQHSVSSQE
EEISSSIDSLFITKLQKITIADQSEPSEENTSTENFPELQSETPKKPHYMKVLEMRARNP
VPPPHKFKTNVLPTQQSDSPSHCQRGQSPASSEEQRRRARQHLDDITAARLLPLHHLPAQ
LLSIEESLALQREQKQNYEEMQAKLAAQKLAERLNIKMQSYNPEGESSGRYREVRDEADA
QSSDEC
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgttctcgctgccccgcggcttcgagcccccagctcccgaggacttggggcggcagagt
tcggcggagctgcgggagaggttgaggcgccaggagagacttttgcgcaacgaaaaattc
atttgcaaattgcccgacaaaggtaaaaagatctcagacacagttgccaaactgaaagct
gccatttcagaacgtgaagaggttagagggagaagtgaactgtttcatcctgttagtgta
gactgtaagctaaggcaaaaagcaaccacaagagctgacaccgatgtagacaaggcccag
agttctgacctgatgcttgatacttcatcattagatcctgactgttcctcaatagacatt
aagtcatctaaatcaacctcagaaacacagggacctacacatctcactcacagaggcaat
gaagagactttggaggctggctacacagtaaacagcagcccagctgcccacatccgagcc
cgggcgccctcatccgaagttaaggagcatctcccccagcactctgtttcaagtcaagag
gaagagatctccagcagcatcgacagtctcttcatcactaaattgcaaaaaatcacaatt
gcagaccagagtgaaccctcagaagaaaacaccagcactgagaactttccagaactgcag
agtgagactcctaagaagcctcattacatgaaagtgctagaaatgcgagccagaaaccca
gtgccccctcctcataagtttaagaccaatgtgttacccacacaacagagtgactcacca
agtcattgtcagaggggccagtctcctgcttcctcagaagagcagcgacgaagggctagg
cagcatcttgatgatatcacagcagcgcgcctccttccgctccaccacctgcctgcacag
ctgctttccatagaagagtcgctggccctgcagagggagcagaagcagaattatgaggag
atgcaggcaaagctcgcagcacagaaactggccgagagactgaatattaaaatgcagagc
tacaatccagaaggggagtcttcagggagataccgagaagtgagggacgaagctgatgcc
cagtcctcggatgagtgctga

DBGET integrated database retrieval system