KEGG   Mus musculus (mouse): 280287
Entry
280287            CDS       T01002                                 

Gene name
Kiss1, kisspeptin, metastatin
Definition
(RefSeq) KiSS-1 metastasis-suppressor
  KO
K23140  metastasis-suppressor KiSS-1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04929  GnRH secretion
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    280287 (Kiss1)
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    280287 (Kiss1)
SSDB
Motif
Pfam: Kisspeptin
Other DBs
NCBI-GeneID: 280287
NCBI-ProteinID: NP_839991
MGI: 2663985
Ensembl: ENSMUSG00000116158
Vega: OTTMUSG00000044883
UniProt: Q6Y4S4 I0J0X7
Position
1; 1 E4
AA seq 126 aa
MISMASWQLLLLLCVATYGEPLAKVKPGSTGQQSGPQELVNAWEKESRYAESKPGSAGLR
ARRSSPCPPVEGPAGRQRPLCASRSRLIPAPRGAVLVQREKDLSTYNWNSFGLRYGRRQA
ARAARG
NT seq 381 nt   +upstreamnt  +downstreamnt
atgatctcaatggcttcttggcagctgctgcttctcctctgtgtcgccacctatggggag
ccgctggcaaaagtgaagcctggatccacaggccagcagtccggaccccaggaactcgtt
aatgcctgggaaaaggaatcgcggtatgcagagagcaagcctgggtctgcagggctgcgc
gctcgtaggtcgtcgccatgcccgccggttgagggccccgcggggcgccagcggcccctg
tgtgcctcccgcagtcgcctgatccctgcgccccgcggagcggtgctggtgcagcgggag
aaggacctgtccacctacaactggaactccttcggcctgcgctacggcaggaggcaggcg
gcgcgggcagcacggggctga

DBGET integrated database retrieval system