KEGG   Mus musculus (house mouse): 280408
Entry
280408            CDS       T01002                                 
Symbol
Rilp, AI835553, Gm857
Name
(RefSeq) Rab interacting lysosomal protein
  KO
K13883  Rab-interacting lysosomal protein
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04145  Phagosome
mmu05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    280408 (Rilp)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    280408 (Rilp)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    280408 (Rilp)
Membrane trafficking [BR:mmu04131]
 Endosome - Lysosome transport
  Rab GTPases and associated proteins
   Rab associated proteins
    280408 (Rilp)
SSDB
Motif
Pfam: RILP Jnk-SapK_ap_N Macoilin
Other DBs
NCBI-GeneID: 280408
NCBI-ProteinID: NP_001025109
MGI: 2144271
Ensembl: ENSMUSG00000038195
UniProt: Q5ND29 Q14AQ2
Position
11:75400920..75403994
AA seq 369 aa
MEPRRAAPRLPSQASSSVGAGSAAELVYHLAGALGTELQGLARRFGPDAAAGLVPLVVRA
LELLEKAAVGPAPDSLQVSAQQAEVELRRLREENQRLRQELGSGPQEERALLRQLKEVTD
RQRDELRAHNRDLQRRSQETEALQEQLQRLLLINSELRHKLAAVQTQLRAAQDRERERQI
AQDGSSQLAKEQSLEPDAATSDDPVDTQKQPGNLPEAVQCGFSREELKQILQERNELKAN
VFLLKEELAYFQRELLTDHRVPGLLLEAMKVAVKKQRRKIKAKMLGTPEEAESSEDEDGS
WLLLSNDKEDVPLVPESRIQNFFGLWYRGETEAPEAETSNPASSSLQKGEETPQQPHLQP
VNSPPAPNS
NT seq 1110 nt   +upstreamnt  +downstreamnt
atggagcccaggagggcagcgcccaggctacccagtcaggcctcttcttcagtgggcgca
gggtcagccgccgagctcgtgtaccatctagcgggggctctgggcactgagctacagggg
ctggcacgccgcttcggacccgacgcggcggctgggctggtgccactagtcgtgcgggcg
ctggagctcttggaaaaggccgccgtggggccggctccggactcgctgcaggtgtccgca
cagcaggcagaagtggagctgcggcggctgcgcgaggagaaccaacgcctccgccaggag
ctaggctccgggccgcaggaggagcgcgcgctgctccgacagctcaaggaggtgacagac
agacagcgggatgagcttcgggcacacaaccgagatctgcagcgccgaagccaagagacc
gaagcgctgcaggaacagctacagcgcctcctgctgatcaactctgagctgcggcacaag
ctggctgcagtgcagacccagttgagggccgcccaggaccgggagagggagcgccagata
gctcaggatggctccagccagctggctaaagaacagagcttggaacctgatgcggcaacc
tcagatgacccggtggatactcagaagcagccagggaaccttccagaagctgtccagtgt
ggattcagcagggaagagcttaagcaaatccttcaggagcggaatgagctcaaagccaac
gtgttcttgctcaaggaggagttggcgtacttccagcgagagctgctcacagatcaccgt
gttcctgggcttctgcttgaagccatgaaggtggcagtcaagaaacagaggaggaagatc
aaggccaagatgttagggacacctgaagaagcagagagcagtgaggatgaggatggctcg
tggctcctgctctccaacgacaaggaagatgttcccctagttcctgagtccagaatccag
aatttctttggcttatggtatcggggtgaaactgaggcccctgaagccgagaccagcaac
ccagcttccagcagcctacagaaaggagaagagaccccacagcaaccccacctgcagcct
gtgaacagccctccagcccccaactcctga

DBGET integrated database retrieval system