KEGG   Mus musculus (mouse): 28064
Entry
28064             CDS       T01002                                 

Symbol
Yipf3, C6orf109, D17Wsu94, D17Wsu94e, KLIP1
Name
(RefSeq) Yip1 domain family, member 3
  KO
K22941  protein YIPF3
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    28064 (Yipf3)
Membrane trafficking [BR:mmu04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Others
   YIPF proteins
    28064 (Yipf3)
SSDB
Motif
Pfam: Yip1 YIF1 Romo1
Other DBs
NCBI-GeneID: 28064
NCBI-ProteinID: NP_663328
MGI: 106280
Ensembl: ENSMUSG00000071074
Vega: OTTMUSG00000028839
UniProt: Q3UDR8
Position
17 C; 17 22.9 cM
AA seq 347 aa
MATPAAPASGVRNGAGPEWGGFEENIQGGGSAVIDMENMDDTSGSSFEDMGELHQRLREE
EVDADAAAAEEEDGEFLGMKGFKGQLSRQVADQMWQAGKRQASRAFSLYANIDILRPYFD
VEPAQVRSRLLESMIPIKMVNFPQKVAGELYGPLMLVFTLVAILLHGMKTSDTIIREGTL
MGTAIGTCFGYWLGVSSFIYFLAYLCNAQITMLQMLALLGYGLFGHCIVLFITYNIHLHA
LFYLFWLLVGGLSTLRMVAVLVSRTVGPTQRLLLCGTLAALHMLFLLYLHFAYHKVVEGI
LDTLEGPNIPPMQRVPRDIPAVLPAARLPVAVINATAKAIAVTLQSH
NT seq 1044 nt   +upstreamnt  +downstreamnt
atggcgactccggcggcgccggccagcggcgtccgaaatggtgctggcccggaatgggga
ggcttcgaagaaaacatccagggtgggggttcggctgtgattgatatggagaacatggac
gatacctcaggctccagcttcgaggacatgggtgagctgcaccagcgcctgcgggaggaa
gaagtagatgctgatgcagctgctgcagaagaagaggatggggagtttcttggcatgaaa
ggctttaaaggacaactgagccggcaggtagcagatcagatgtggcaggcagggaagaga
caggcttccagggccttcagcttgtatgccaacattgacatcctcagaccctactttgat
gtggagcctgcccaggtccgaagcaggctcctggagtccatgatccctatcaagatggtc
aacttcccccagaaagtcgcgggcgagctctacggaccgctcatgctggtcttcacactg
gtggccatcctcctgcatggaatgaagacttctgacaccattatccgggagggcaccctc
atgggcacagccataggcacctgctttggatactggctgggtgtctcgtccttcatttat
ttccttgcctacctgtgtaacgcccagatcaccatgctacagatgttggcactgctgggc
tacggcctcttcgggcactgcatagtcctgttcatcacctataacatccaccttcatgcc
ctcttctacctcttctggctgctggtgggtgggctctctaccctgcgcatggtggcagtg
ttggtgtcgcggactgtgggccctactcagcggctgctgctctgtggcacgctggctgcc
ctgcacatgctcttcctgctctatctgcacttcgcctaccacaaagtggtggaggggatc
ctggacaccctggagggccccaacatcccacccatgcagagggtccccagagacatcccc
gctgtgctccctgctgccaggctgcccgtcgctgtgatcaatgctaccgccaaggcaata
gcagtgactctgcagtcacattga

DBGET integrated database retrieval system