KEGG   Mus musculus (house mouse): 280645
Entry
280645            CDS       T01002                                 
Symbol
B3gat2, GlcAT-S, Glcats
Name
(RefSeq) beta-1,3-glucuronyltransferase 2 (glucuronosyltransferase S)
  KO
K10157  galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 2 [EC:2.4.1.135]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00515  Mannose type O-glycan biosynthesis
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00515 Mannose type O-glycan biosynthesis
    280645 (B3gat2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mmu01003]
    280645 (B3gat2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.135  galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase
     280645 (B3gat2)
Glycosyltransferases [BR:mmu01003]
 Glycan extension
  O-Glycan
   280645 (B3gat2)
SSDB
Motif
Pfam: Glyco_transf_43
Other DBs
NCBI-GeneID: 280645
NCBI-ProteinID: NP_742122
MGI: 2389490
Ensembl: ENSMUSG00000026156
UniProt: P59270
Position
1:23801007..23886946
AA seq 324 aa
MKSALCSRFFILLPWILIVIIMLDVDPRRPAPQLTSRPYFSPHAVGCGGSRVPLRRSSPG
RDAAEKRNESRPQLQPEPRLPTIYAITPTYSRPVQKAELTRLANTFRQVAQLHWILVEDR
ATRSELVSSFLARAGLPNTHLHVPTPRRYKRPWLPRATEQRNAGLAWLRQRHQHQSAQPG
VLFFADDDNTYSLELFQEMRTTRKVSVWPVGLVGGRRYERPLVKNGKVVGWYTGWREDRP
FAIDMAGFAVSLQVILSNPKAVFKRRGSQPGMQESDFLKQITTVEELEPKASNCTKVLVW
HTRTEKVNLANEPKYHLDTVNIEV
NT seq 975 nt   +upstreamnt  +downstreamnt
atgaagtccgcgctgtgcagccgcttcttcatcctcctgccctggatcctgattgtcatc
atcatgttggacgtggacccccgcaggcccgcgccccaactcacttcccgtccctacttc
tctccccatgcagtgggctgcgggggctcccgagtcccgctccgacggagtagccccggg
cgtgacgctgccgagaagcggaacgagtctcggcctcagctgcagccggagccgcgcttg
cccaccatctatgccatcacacccacctacagtcgcccggtgcagaaagccgagctcact
cgcctggccaacaccttccgccaggtggcgcagttgcactggatcctggtggaggaccgg
gcgacgcgcagcgagctggtgagcagcttcctagctcgggccggcctgcccaacacgcac
ctgcatgtgcccacgccgcggcgctacaagcgaccgtggctgccgcgcgccaccgaacag
cgcaacgcgggcctcgcctggctgcgccagaggcatcagcatcagagcgcgcaacccggc
gtgctcttcttcgccgacgatgacaacacgtacagtctggagctcttccaggagatgagg
accactcgcaaggtttctgtctggcctgtgggactagttggtgggcgacgctatgaacgt
ccgttggtaaaaaatggcaaagttgttggctggtacaccggatggagagaagacaggcct
tttgccattgacatggctgggtttgctgtgagtctgcaagtcatcttgtccaatccgaaa
gctgtatttaagcgccgtggatcccagccagggatgcaagaatctgactttctaaagcag
ataacaacagttgaagaactggaaccaaaagctagtaactgcaccaaggttctcgtgtgg
cacactcggacagagaaggtcaatctagccaatgagccaaagtatcacctggacacagtg
aacattgaggtgtag

DBGET integrated database retrieval system