KEGG   Mus musculus (mouse): 28071
Entry
28071             CDS       T01002                                 

Gene name
Polr1f, 2410173G11, 2810024J17Rik, D16Wsu83, D16Wsu83e, Twistnb
Definition
(RefSeq) RNA polymerase I subunit F
  KO
K03004  DNA-directed RNA polymerase I subunit RPA43
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    28071 (Polr1f)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mmu03021]
    28071 (Polr1f)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase I system
   RNA polymerase I
    Pol I specific subunits
     28071 (Polr1f)
SSDB
Motif
Pfam: RPA43_OB SHS2_Rpb7-N Med19
Other DBs
NCBI-GeneID: 28071
NCBI-ProteinID: NP_758457
MGI: 106292
Ensembl: ENSMUSG00000020561
UniProt: Q78WZ7 B2RT77
Position
12; 12 A3
AA seq 330 aa
MAAGSVESQRSQAASERPVAGQAGVLPCLELPSYAAACALVGSRYSCLVAAPHRRHIALS
PRYLSRKRTGIREQLDAELLRYSESLLGVPIAYDNIRVVGELGDIYDDQGHIHLNIEADF
VIFCPEPGQTLMGTVNKVSSSHIGCLVHGCFNASIPKPEQMSYEEWQTLEIHVGDELEFD
VFRLDSDSAGVFCIRGKLSTTSLQLKHSAVSEDVAETVVEEVVEKTPKKKKKKKDKDTDT
CGTVDSVTEVADVTDVTPQEETDIPCSDNVNDFFEEEPKKKKKKKKRHQEDQDPIFQASD
SSGYQSDHNKKKKKRKHSEEANFESPKKRQ
NT seq 993 nt   +upstreamnt  +downstreamnt
atggctgcgggatctgtggagtctcagcggtcccaggcggcctccgagaggcccgtggcg
ggtcaggccggggtcctgccttgcctggagttgccgagctacgcggcggcgtgcgcgctg
gtgggcagccgctattcgtgcttggtggctgccccgcaccgcaggcacatcgccctgtcg
ccccgctacctgagcaggaagcgcacgggcatccgcgagcagctggacgccgagctcctg
cgctactccgagagccttttaggtgtccctattgcatatgataacatcagagttgtgggt
gaactaggagatatttatgatgatcaaggacacattcatcttaacattgaagcagatttt
gttattttctgccctgagcctgggcagacgttaatgggtacagttaataaagtatcgtct
agccatattggctgtctagtccatggatgttttaacgcctctatccctaagcctgagcag
atgtcatatgaggagtggcaaacattggagatacatgtaggcgatgaactggaatttgat
gtatttcgcttagattcagattctgctggagtgttctgcattcgaggaaaactgagtacc
accagtttgcaacttaagcactctgcagtttctgaagatgtagcagaaactgtcgttgaa
gaggttgttgaaaaaactccaaagaagaaaaagaagaagaaagacaaagatacagacaca
tgtggaacagttgatagtgttacagaggttgcagatgttacagatgtcacgccacaggaa
gaaacagacataccatgtagtgataatgtgaatgacttctttgaggaagagccaaagaag
aagaaaaagaagaagaaaaggcaccaggaagatcaggaccccattttccaagccagtgac
tccagtggctaccagagtgaccataacaagaaaaaaaagaaaagaaagcacagtgaagag
gctaactttgagtcacctaagaagagacagtaa

DBGET integrated database retrieval system