KEGG   Mus musculus (house mouse): 28109
Entry
28109             CDS       T01002                                 
Symbol
Nopchap1, C430041I18Rik, D10Wsu102e
Name
(RefSeq) NOP protein chaperone 1
  KO
K26142  NOP protein chaperone 1
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:mmu03009]
    28109 (Nopchap1)
Ribosome biogenesis [BR:mmu03009]
 Eukaryotic type
  Other ribosome biogenesis factors
   28109 (Nopchap1)
SSDB
Motif
Pfam: NOPCHAP1
Other DBs
NCBI-GeneID: 28109
NCBI-ProteinID: NP_080855
MGI: 106381
Ensembl: ENSMUSG00000020255
UniProt: Q9CX66
Position
10:83196085..83204699
AA seq 185 aa
MEFQGERGTGPGVSSSSVACSQVTVSRELLTAGSEGSGGIWDQLLISSKPHPRKTSTLQT
VRMQRSPLLDQVQAFLPQMAQANEKLRREMAAAPAGHFNIENIDETSGNIIQMDVALFEM
SRSDSKEEDSPEESSRDSSGDSSESEEDVCVPSEVTIENIKLPNAEGGKGKIEILDSPAS
KKKKQ
NT seq 558 nt   +upstreamnt  +downstreamnt
atggagttccagggcgagcgcgggaccggtcctggtgtttcttcgtcttctgtagcctgc
tcgcaggtcacggtgtccagggagctgctgacggcggggagcgagggttcgggaggtatc
tgggaccagttgctcatcagctctaagcctcatcccagaaagacctctacacttcaaaca
gttcggatgcagaggagccctttgctagaccaggttcaggccttcctcccacaaatggcc
caggcaaatgagaagctgaggagggaaatggcagctgctccagctggtcacttcaatatt
gaaaacatcgacgagacgtctggaaacatcatacagatggatgtggccttatttgagatg
agtcggtcagattcaaaagaggaggatagcccagaagagagctctcgggacagttctggg
gacagctcggagtccgaagaagatgtctgcgttccctctgaagtcaccatcgagaacatt
aagcttccgaatgcagaaggtggcaaaggcaagattgaaattttggacagtccggcaagt
aaaaaaaagaagcagtga

DBGET integrated database retrieval system