KEGG   Mus musculus (mouse): 28126
Entry
28126             CDS       T01002                                 

Gene name
Nop16, AA409471, D13Wsu177e
Definition
(RefSeq) NOP16 nucleolar protein
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: Nop16 Baculo_p33 AdoMet_dc
Other DBs
NCBI-GeneID: 28126
NCBI-ProteinID: NP_848720
MGI: 107862
Ensembl: ENSMUSG00000025869
Vega: OTTMUSG00000032680
UniProt: Q9CPT5
Position
13 B1; 13 28.83 cM
AA seq 178 aa
MPKAKGKTRRQKFGYNVNRKRLNRNARRKAAPRIECSHIRHAWDHTKSVRQNLAEMGLAM
DPNKAVPLRKKKVKAMEVDTEERPRDLVRKPYVVNDLEAEASLPEKKGNTLSRDLIDYVR
YMVENHGEDYKAMARDEKNYYQDTPKQIRNKINVYKRFYPTEWQAFIDSLQSKKMEVD
NT seq 537 nt   +upstreamnt  +downstreamnt
atgcccaaggctaagggaaagactcggaggcagaagttcggttacaacgtcaaccgaaag
cgtctgaaccggaatgctcgtcggaaggcagcgccacggattgagtgttcccacatacga
catgcctgggaccacaccaaatccgtgcggcagaacctggcggagatggggttggccatg
gaccccaacaaggcggttcccctccgtaagaagaaggtaaaggccatggaggtagacacg
gaggagcgaccccgggatcttgtacggaagccctatgtggtaaatgacctggaggcagaa
gccagcctcccagagaagaaaggaaataccttgtctcgggacctcatcgactatgtgcgg
tacatggtagagaatcacggggaggactacaaggccatggcccgggatgagaagaattac
taccaagacaccccaaaacagatccggaataagatcaatgtctataagcgcttttaccca
acggagtggcaagccttcatcgattctctgcagagtaagaagatggaggtagactga

DBGET integrated database retrieval system